KEGG   Myotis lucifugus (little brown bat): 102422236
Entry
102422236         CDS       T07795                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mlf  Myotis lucifugus (little brown bat)
Pathway
mlf01521  EGFR tyrosine kinase inhibitor resistance
mlf01522  Endocrine resistance
mlf01524  Platinum drug resistance
mlf04010  MAPK signaling pathway
mlf04012  ErbB signaling pathway
mlf04014  Ras signaling pathway
mlf04015  Rap1 signaling pathway
mlf04022  cGMP-PKG signaling pathway
mlf04024  cAMP signaling pathway
mlf04062  Chemokine signaling pathway
mlf04066  HIF-1 signaling pathway
mlf04068  FoxO signaling pathway
mlf04071  Sphingolipid signaling pathway
mlf04072  Phospholipase D signaling pathway
mlf04114  Oocyte meiosis
mlf04140  Autophagy - animal
mlf04148  Efferocytosis
mlf04150  mTOR signaling pathway
mlf04151  PI3K-Akt signaling pathway
mlf04210  Apoptosis
mlf04218  Cellular senescence
mlf04261  Adrenergic signaling in cardiomyocytes
mlf04270  Vascular smooth muscle contraction
mlf04350  TGF-beta signaling pathway
mlf04360  Axon guidance
mlf04370  VEGF signaling pathway
mlf04371  Apelin signaling pathway
mlf04380  Osteoclast differentiation
mlf04510  Focal adhesion
mlf04520  Adherens junction
mlf04540  Gap junction
mlf04550  Signaling pathways regulating pluripotency of stem cells
mlf04611  Platelet activation
mlf04613  Neutrophil extracellular trap formation
mlf04620  Toll-like receptor signaling pathway
mlf04621  NOD-like receptor signaling pathway
mlf04625  C-type lectin receptor signaling pathway
mlf04650  Natural killer cell mediated cytotoxicity
mlf04657  IL-17 signaling pathway
mlf04658  Th1 and Th2 cell differentiation
mlf04659  Th17 cell differentiation
mlf04660  T cell receptor signaling pathway
mlf04662  B cell receptor signaling pathway
mlf04664  Fc epsilon RI signaling pathway
mlf04666  Fc gamma R-mediated phagocytosis
mlf04668  TNF signaling pathway
mlf04713  Circadian entrainment
mlf04720  Long-term potentiation
mlf04722  Neurotrophin signaling pathway
mlf04723  Retrograde endocannabinoid signaling
mlf04724  Glutamatergic synapse
mlf04725  Cholinergic synapse
mlf04726  Serotonergic synapse
mlf04730  Long-term depression
mlf04810  Regulation of actin cytoskeleton
mlf04910  Insulin signaling pathway
mlf04912  GnRH signaling pathway
mlf04914  Progesterone-mediated oocyte maturation
mlf04915  Estrogen signaling pathway
mlf04916  Melanogenesis
mlf04917  Prolactin signaling pathway
mlf04919  Thyroid hormone signaling pathway
mlf04921  Oxytocin signaling pathway
mlf04926  Relaxin signaling pathway
mlf04928  Parathyroid hormone synthesis, secretion and action
mlf04929  GnRH secretion
mlf04930  Type II diabetes mellitus
mlf04933  AGE-RAGE signaling pathway in diabetic complications
mlf04934  Cushing syndrome
mlf04935  Growth hormone synthesis, secretion and action
mlf04960  Aldosterone-regulated sodium reabsorption
mlf05010  Alzheimer disease
mlf05020  Prion disease
mlf05022  Pathways of neurodegeneration - multiple diseases
mlf05034  Alcoholism
mlf05132  Salmonella infection
mlf05133  Pertussis
mlf05135  Yersinia infection
mlf05140  Leishmaniasis
mlf05142  Chagas disease
mlf05145  Toxoplasmosis
mlf05152  Tuberculosis
mlf05160  Hepatitis C
mlf05161  Hepatitis B
mlf05163  Human cytomegalovirus infection
mlf05164  Influenza A
mlf05165  Human papillomavirus infection
mlf05166  Human T-cell leukemia virus 1 infection
mlf05167  Kaposi sarcoma-associated herpesvirus infection
mlf05170  Human immunodeficiency virus 1 infection
mlf05171  Coronavirus disease - COVID-19
mlf05200  Pathways in cancer
mlf05203  Viral carcinogenesis
mlf05205  Proteoglycans in cancer
mlf05206  MicroRNAs in cancer
mlf05207  Chemical carcinogenesis - receptor activation
mlf05208  Chemical carcinogenesis - reactive oxygen species
mlf05210  Colorectal cancer
mlf05211  Renal cell carcinoma
mlf05212  Pancreatic cancer
mlf05213  Endometrial cancer
mlf05214  Glioma
mlf05215  Prostate cancer
mlf05216  Thyroid cancer
mlf05218  Melanoma
mlf05219  Bladder cancer
mlf05220  Chronic myeloid leukemia
mlf05221  Acute myeloid leukemia
mlf05223  Non-small cell lung cancer
mlf05224  Breast cancer
mlf05225  Hepatocellular carcinoma
mlf05226  Gastric cancer
mlf05230  Central carbon metabolism in cancer
mlf05231  Choline metabolism in cancer
mlf05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mlf05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mlf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102422236 (MAPK3)
   04012 ErbB signaling pathway
    102422236 (MAPK3)
   04014 Ras signaling pathway
    102422236 (MAPK3)
   04015 Rap1 signaling pathway
    102422236 (MAPK3)
   04350 TGF-beta signaling pathway
    102422236 (MAPK3)
   04370 VEGF signaling pathway
    102422236 (MAPK3)
   04371 Apelin signaling pathway
    102422236 (MAPK3)
   04668 TNF signaling pathway
    102422236 (MAPK3)
   04066 HIF-1 signaling pathway
    102422236 (MAPK3)
   04068 FoxO signaling pathway
    102422236 (MAPK3)
   04072 Phospholipase D signaling pathway
    102422236 (MAPK3)
   04071 Sphingolipid signaling pathway
    102422236 (MAPK3)
   04024 cAMP signaling pathway
    102422236 (MAPK3)
   04022 cGMP-PKG signaling pathway
    102422236 (MAPK3)
   04151 PI3K-Akt signaling pathway
    102422236 (MAPK3)
   04150 mTOR signaling pathway
    102422236 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102422236 (MAPK3)
   04148 Efferocytosis
    102422236 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102422236 (MAPK3)
   04210 Apoptosis
    102422236 (MAPK3)
   04218 Cellular senescence
    102422236 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102422236 (MAPK3)
   04520 Adherens junction
    102422236 (MAPK3)
   04540 Gap junction
    102422236 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    102422236 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102422236 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102422236 (MAPK3)
   04613 Neutrophil extracellular trap formation
    102422236 (MAPK3)
   04620 Toll-like receptor signaling pathway
    102422236 (MAPK3)
   04621 NOD-like receptor signaling pathway
    102422236 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    102422236 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    102422236 (MAPK3)
   04660 T cell receptor signaling pathway
    102422236 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    102422236 (MAPK3)
   04659 Th17 cell differentiation
    102422236 (MAPK3)
   04657 IL-17 signaling pathway
    102422236 (MAPK3)
   04662 B cell receptor signaling pathway
    102422236 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    102422236 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    102422236 (MAPK3)
   04062 Chemokine signaling pathway
    102422236 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102422236 (MAPK3)
   04929 GnRH secretion
    102422236 (MAPK3)
   04912 GnRH signaling pathway
    102422236 (MAPK3)
   04915 Estrogen signaling pathway
    102422236 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    102422236 (MAPK3)
   04917 Prolactin signaling pathway
    102422236 (MAPK3)
   04921 Oxytocin signaling pathway
    102422236 (MAPK3)
   04926 Relaxin signaling pathway
    102422236 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    102422236 (MAPK3)
   04919 Thyroid hormone signaling pathway
    102422236 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    102422236 (MAPK3)
   04916 Melanogenesis
    102422236 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102422236 (MAPK3)
   04270 Vascular smooth muscle contraction
    102422236 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102422236 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    102422236 (MAPK3)
   04725 Cholinergic synapse
    102422236 (MAPK3)
   04726 Serotonergic synapse
    102422236 (MAPK3)
   04720 Long-term potentiation
    102422236 (MAPK3)
   04730 Long-term depression
    102422236 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    102422236 (MAPK3)
   04722 Neurotrophin signaling pathway
    102422236 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    102422236 (MAPK3)
   04380 Osteoclast differentiation
    102422236 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102422236 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102422236 (MAPK3)
   05206 MicroRNAs in cancer
    102422236 (MAPK3)
   05205 Proteoglycans in cancer
    102422236 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    102422236 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    102422236 (MAPK3)
   05203 Viral carcinogenesis
    102422236 (MAPK3)
   05230 Central carbon metabolism in cancer
    102422236 (MAPK3)
   05231 Choline metabolism in cancer
    102422236 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102422236 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102422236 (MAPK3)
   05212 Pancreatic cancer
    102422236 (MAPK3)
   05225 Hepatocellular carcinoma
    102422236 (MAPK3)
   05226 Gastric cancer
    102422236 (MAPK3)
   05214 Glioma
    102422236 (MAPK3)
   05216 Thyroid cancer
    102422236 (MAPK3)
   05221 Acute myeloid leukemia
    102422236 (MAPK3)
   05220 Chronic myeloid leukemia
    102422236 (MAPK3)
   05218 Melanoma
    102422236 (MAPK3)
   05211 Renal cell carcinoma
    102422236 (MAPK3)
   05219 Bladder cancer
    102422236 (MAPK3)
   05215 Prostate cancer
    102422236 (MAPK3)
   05213 Endometrial cancer
    102422236 (MAPK3)
   05224 Breast cancer
    102422236 (MAPK3)
   05223 Non-small cell lung cancer
    102422236 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102422236 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    102422236 (MAPK3)
   05161 Hepatitis B
    102422236 (MAPK3)
   05160 Hepatitis C
    102422236 (MAPK3)
   05171 Coronavirus disease - COVID-19
    102422236 (MAPK3)
   05164 Influenza A
    102422236 (MAPK3)
   05163 Human cytomegalovirus infection
    102422236 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102422236 (MAPK3)
   05165 Human papillomavirus infection
    102422236 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102422236 (MAPK3)
   05135 Yersinia infection
    102422236 (MAPK3)
   05133 Pertussis
    102422236 (MAPK3)
   05152 Tuberculosis
    102422236 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102422236 (MAPK3)
   05140 Leishmaniasis
    102422236 (MAPK3)
   05142 Chagas disease
    102422236 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102422236 (MAPK3)
   05020 Prion disease
    102422236 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    102422236 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    102422236 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102422236 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102422236 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102422236 (MAPK3)
   04934 Cushing syndrome
    102422236 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102422236 (MAPK3)
   01524 Platinum drug resistance
    102422236 (MAPK3)
   01522 Endocrine resistance
    102422236 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mlf01001]
    102422236 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mlf03036]
    102422236 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlf04147]
    102422236 (MAPK3)
Enzymes [BR:mlf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102422236 (MAPK3)
Protein kinases [BR:mlf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102422236 (MAPK3)
Chromosome and associated proteins [BR:mlf03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102422236 (MAPK3)
Exosome [BR:mlf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102422236 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 102422236
NCBI-ProteinID: XP_023600425
Ensembl: ENSMLUG00000011284
LinkDB
Position
Unknown
AA seq 445 aa
LPPSPGICLTVCPALVSQPPTCPGCGSPSRGGAGQPEGSGLQRGEVSGRSSSLCEVTEGL
PGRSPAFSLESAGLRSRKEPALFTTWPEPTRLPPFPATAWVGPAGLDSPSVGPHQHHLSG
PLSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVISIRDILRAPTLDA
MRDVYIVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPPKTKVAWAK
LFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDD
LPKERLKELIFQETARFQPGVLEAT
NT seq 1338 nt   +upstreamnt  +downstreamnt
ctccctccttcccccggtatttgcctcactgtctgccctgcactcgtctcccagcccccg
acctgtccaggctgcgggagcccatcgcggggcggggcagggcagcccgaagggagcggg
ctgcagagaggggaagtcagcggccgctcttcctctctttgtgaagtcaccgaagggctg
cctggccggtccccagctttctccctggagagcgcaggccttcgcagcaggaaggaacca
gcattgtttacgacttggccagagcccactcggctccctcccttcccggccacggcctgg
gtggggccagccggcctggactccccctctgtaggaccacaccaacaccacctctctggc
cctctcagctcagcttacgaccacgtccgcaagacacgcgtggccatcaagaaaatcagc
cccttcgagcaccagacctactgccagcgcacgctgcgggaaatccagatcttgctgcgc
ttccgccacgagaatgtcatcagcatccgagacattcttcgggcacctaccctggatgcc
atgagggatgtctacatcgtgcaggacctgatggagacagacctgtacaagttgctcaaa
agccagcagctgagcaacgaccacgtctgctacttcctctaccagatcctgcggggcctc
aagtatatccactcagcgaacgtgctccaccgggatttaaagccctccaacctgctcatc
aacaccacctgcgaccttaagatctgcgattttggcctggcccggatcgccgatcccgag
catgaccacactggcttcctgacagaatacgtggccacgcgctggtaccgggccccagag
atcatgctgaactccaagggctacaccaagtccatcgatatctggtctgtgggctgcatt
ctggctgaaatgctctccaaccgacccatcttccctggcaagcactacctggaccagctc
aaccacattctgggcatcctgggttccccatcccaagaggacctgaattgtatcatcaac
atgaaggcccggaactacctgcagtctctgcctcccaagaccaaggtggcctgggccaag
ctcttccccaagtccgactccaaagcccttgacctgctggaccggatgttgacctttaac
cctaataaacggatcacagtagaagaagccctggctcacccctacctggagcagtactac
gacccaacagatgagccagtggccgaggaacctttcacctttgacatggagctggatgat
ctacccaaggagcggctgaaggagctcatattccaggagacagcccgcttccagcctggg
gtgctggaggccacctaa

DBGET integrated database retrieval system