Myotis lucifugus (little brown bat): 102422264 Help Entry 102422264         CDS       T07795                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04022   cGMP-PKG signaling pathway mlf04024   cAMP signaling pathway mlf04062   Chemokine signaling pathway mlf04071   Sphingolipid signaling pathway mlf04072   Phospholipase D signaling pathway mlf04081   Hormone signaling mlf04144   Endocytosis mlf04150   mTOR signaling pathway mlf04270   Vascular smooth muscle contraction mlf04310   Wnt signaling pathway mlf04350   TGF-beta signaling pathway mlf04360   Axon guidance mlf04510   Focal adhesion mlf04520   Adherens junction mlf04530   Tight junction mlf04611   Platelet activation mlf04621   NOD-like receptor signaling pathway mlf04625   C-type lectin receptor signaling pathway mlf04660   T cell receptor signaling pathway mlf04670   Leukocyte transendothelial migration mlf04722   Neurotrophin signaling pathway mlf04810   Regulation of actin cytoskeleton mlf04921   Oxytocin signaling pathway mlf04928   Parathyroid hormone synthesis, secretion and action mlf04972   Pancreatic secretion mlf05100   Bacterial invasion of epithelial cells mlf05132   Salmonella infection mlf05133   Pertussis mlf05135   Yersinia infection mlf05152   Tuberculosis mlf05163   Human cytomegalovirus infection mlf05200   Pathways in cancer mlf05203   Viral carcinogenesis mlf05205   Proteoglycans in cancer mlf05206   MicroRNAs in cancer mlf05210   Colorectal cancer mlf05417   Lipid and atherosclerosis mlf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102422264 (RHOA)    04015 Rap1 signaling pathway     102422264 (RHOA)    04310 Wnt signaling pathway     102422264 (RHOA)    04350 TGF-beta signaling pathway     102422264 (RHOA)    04072 Phospholipase D signaling pathway     102422264 (RHOA)    04071 Sphingolipid signaling pathway     102422264 (RHOA)    04024 cAMP signaling pathway     102422264 (RHOA)    04022 cGMP-PKG signaling pathway     102422264 (RHOA)    04150 mTOR signaling pathway     102422264 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102422264 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102422264 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102422264 (RHOA)    04660 T cell receptor signaling pathway     102422264 (RHOA)    04670 Leukocyte transendothelial migration     102422264 (RHOA)    04062 Chemokine signaling pathway     102422264 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     102422264 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     102422264 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     102422264 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102422264 (RHOA)   09158 Development and regeneration    04360 Axon guidance     102422264 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102422264 (RHOA)    05206 MicroRNAs in cancer     102422264 (RHOA)    05205 Proteoglycans in cancer     102422264 (RHOA)    05203 Viral carcinogenesis     102422264 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     102422264 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102422264 (RHOA)   09171 Infectious disease: bacterial    05135 Yersinia infection     102422264 (RHOA)    05133 Pertussis     102422264 (RHOA)    05152 Tuberculosis     102422264 (RHOA)    05100 Bacterial invasion of epithelial cells     102422264 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102422264 (RHOA)    05418 Fluid shear stress and atherosclerosis     102422264 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102422264 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102422264 (RHOA)    04031 GTP-binding proteins [BR:mlf04031]     102422264 (RHOA) Membrane trafficking [BR:mlf04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102422264 (RHOA) Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102422264 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102422264 (RHOA)   Exosomal proteins of colorectal cancer cells    102422264 (RHOA)   Exosomal proteins of bladder cancer cells    102422264 (RHOA) GTP-binding proteins [BR:mlf04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102422264 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102422264 NCBI-ProteinID:  XP_006107030 Ensembl:  ENSMLUG00000013911 UniProt:  G1PNW0 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaattggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtttttagcaaggaccagttcccagaggtgtatgtgcctacggtgtttgag aactatgtggcagacattgaagtggacggaaagcaggtcgagttggctttgtgggacaca gccggacaggaggattatgatcgcttgaggcccctctcctacccggacacggatgttatc ctgatgtgtttctccatcgacagccctgatagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaatgtgcccattatcctggttgggaacaagaaggat cttcgaaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccagtaaaa ccggaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgctca gcaaagaccaaagacggagtgagggaggttttcgaaatggccacgagagctgctctgcag gcccggcgtgggaagaagaaatccgggtgccttgttttgtga

DBGET integrated database retrieval system