Myotis lucifugus (little brown bat): 102422347 Help Entry 102422347         CDS       T07795                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04024   cAMP signaling pathway mlf04062   Chemokine signaling pathway mlf04064   NF-kappa B signaling pathway mlf04210   Apoptosis mlf04380   Osteoclast differentiation mlf04620   Toll-like receptor signaling pathway mlf04621   NOD-like receptor signaling pathway mlf04622   RIG-I-like receptor signaling pathway mlf04623   Cytosolic DNA-sensing pathway mlf04625   C-type lectin receptor signaling pathway mlf04657   IL-17 signaling pathway mlf04658   Th1 and Th2 cell differentiation mlf04659   Th17 cell differentiation mlf04660   T cell receptor signaling pathway mlf04662   B cell receptor signaling pathway mlf04668   TNF signaling pathway mlf04722   Neurotrophin signaling pathway mlf04920   Adipocytokine signaling pathway mlf04926   Relaxin signaling pathway mlf04931   Insulin resistance mlf04936   Alcoholic liver disease mlf05132   Salmonella infection mlf05134   Legionellosis mlf05135   Yersinia infection mlf05140   Leishmaniasis mlf05142   Chagas disease mlf05145   Toxoplasmosis mlf05160   Hepatitis C mlf05161   Hepatitis B mlf05162   Measles mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05166   Human T-cell leukemia virus 1 infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05168   Herpes simplex virus 1 infection mlf05169   Epstein-Barr virus infection mlf05170   Human immunodeficiency virus 1 infection mlf05171   Coronavirus disease - COVID-19 mlf05200   Pathways in cancer mlf05203   Viral carcinogenesis mlf05208   Chemical carcinogenesis - reactive oxygen species mlf05215   Prostate cancer mlf05220   Chronic myeloid leukemia mlf05222   Small cell lung cancer mlf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102422347 (NFKBIA)    04668 TNF signaling pathway     102422347 (NFKBIA)    04024 cAMP signaling pathway     102422347 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102422347 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102422347 (NFKBIA)    04621 NOD-like receptor signaling pathway     102422347 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     102422347 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     102422347 (NFKBIA)    04625 C-type lectin receptor signaling pathway     102422347 (NFKBIA)    04660 T cell receptor signaling pathway     102422347 (NFKBIA)    04658 Th1 and Th2 cell differentiation     102422347 (NFKBIA)    04659 Th17 cell differentiation     102422347 (NFKBIA)    04657 IL-17 signaling pathway     102422347 (NFKBIA)    04662 B cell receptor signaling pathway     102422347 (NFKBIA)    04062 Chemokine signaling pathway     102422347 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102422347 (NFKBIA)    04926 Relaxin signaling pathway     102422347 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102422347 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     102422347 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102422347 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     102422347 (NFKBIA)    05203 Viral carcinogenesis     102422347 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102422347 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     102422347 (NFKBIA)    05215 Prostate cancer     102422347 (NFKBIA)    05222 Small cell lung cancer     102422347 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102422347 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     102422347 (NFKBIA)    05161 Hepatitis B     102422347 (NFKBIA)    05160 Hepatitis C     102422347 (NFKBIA)    05171 Coronavirus disease - COVID-19     102422347 (NFKBIA)    05164 Influenza A     102422347 (NFKBIA)    05162 Measles     102422347 (NFKBIA)    05168 Herpes simplex virus 1 infection     102422347 (NFKBIA)    05163 Human cytomegalovirus infection     102422347 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     102422347 (NFKBIA)    05169 Epstein-Barr virus infection     102422347 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102422347 (NFKBIA)    05135 Yersinia infection     102422347 (NFKBIA)    05134 Legionellosis     102422347 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102422347 (NFKBIA)    05140 Leishmaniasis     102422347 (NFKBIA)    05142 Chagas disease     102422347 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102422347 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102422347 (NFKBIA)    04931 Insulin resistance     102422347 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mlf03000]     102422347 (NFKBIA)    04131 Membrane trafficking [BR:mlf04131]     102422347 (NFKBIA) Transcription factors [BR:mlf03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     102422347 (NFKBIA) Membrane trafficking [BR:mlf04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102422347 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  102422347 NCBI-ProteinID:  XP_006085941 Ensembl:  ENSMLUG00000004519 LinkDB All DBs Position Unknown AA seq 224 aa AA seqDB search MEVVRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAQALLEAGCDPELRDFRGNTPLHL ACEQGSLASVGVLTQSCGTQHLQAILQATNYNGHTCLHLASIHGYLGIVERLVSLGADVN AQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLG QLTLENLQMLPESEDEESYDTESEFTEDELPYDDCVLGGQRLTL NT seq 675 nt NT seq  +upstreamnt  +downstreamnt atggaagtggtccgccaagtgaagggagacctggcctttcttaacttccagaacaacctg cagcagactccgctccacttggctgtgatcaccaaccagccagaaatcgcccaggcactt ctggaagctggctgtgatcctgagctgcgagactttcgaggaaatacccccctacacctt gcctgtgagcagggcagcctggccagtgtgggagtcctgactcagagctgtgggacccag cacctccaggccatcctgcaggccaccaactacaatggccacacatgtctgcacttagcc tccatccatggctacctgggcatcgtggagcgtttggtgtccttgggcgctgatgtcaat gcccaggagccctgtaatggccgaacggcccttcatcttgcagtggatctgcagaatccc gacctggtgtctctcctgctgaagtgtggggctgacgtcaacagagtcacctaccagggc tactccccgtaccagctcacctggggccgcccaagcacccggatacagcagcagctgggc cagctgaccctcgaaaaccttcagatgctgccagagagtgaggatgaggagagctatgac acggagtcggagttcacagaggatgagctgccctacgatgactgtgtgcttggaggccag cgcctgacgttatga

DBGET integrated database retrieval system