KEGG   Myotis lucifugus (little brown bat): 102422583
Entry
102422583         CDS       T07795                                 
Symbol
DDB2
Name
(RefSeq) DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
mlf  Myotis lucifugus (little brown bat)
Pathway
mlf03420  Nucleotide excision repair
mlf04115  p53 signaling pathway
mlf04120  Ubiquitin mediated proteolysis
mlf05161  Hepatitis B
mlf05169  Epstein-Barr virus infection
mlf05200  Pathways in cancer
mlf05202  Transcriptional misregulation in cancer
mlf05210  Colorectal cancer
mlf05212  Pancreatic cancer
mlf05213  Endometrial cancer
mlf05214  Glioma
mlf05216  Thyroid cancer
mlf05217  Basal cell carcinoma
mlf05218  Melanoma
mlf05220  Chronic myeloid leukemia
mlf05222  Small cell lung cancer
mlf05223  Non-small cell lung cancer
mlf05224  Breast cancer
mlf05225  Hepatocellular carcinoma
mlf05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mlf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102422583 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    102422583 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102422583 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102422583 (DDB2)
   05202 Transcriptional misregulation in cancer
    102422583 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102422583 (DDB2)
   05212 Pancreatic cancer
    102422583 (DDB2)
   05225 Hepatocellular carcinoma
    102422583 (DDB2)
   05226 Gastric cancer
    102422583 (DDB2)
   05214 Glioma
    102422583 (DDB2)
   05216 Thyroid cancer
    102422583 (DDB2)
   05220 Chronic myeloid leukemia
    102422583 (DDB2)
   05217 Basal cell carcinoma
    102422583 (DDB2)
   05218 Melanoma
    102422583 (DDB2)
   05213 Endometrial cancer
    102422583 (DDB2)
   05224 Breast cancer
    102422583 (DDB2)
   05222 Small cell lung cancer
    102422583 (DDB2)
   05223 Non-small cell lung cancer
    102422583 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102422583 (DDB2)
   05169 Epstein-Barr virus infection
    102422583 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mlf04121]
    102422583 (DDB2)
   03400 DNA repair and recombination proteins [BR:mlf03400]
    102422583 (DDB2)
Ubiquitin system [BR:mlf04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102422583 (DDB2)
DNA repair and recombination proteins [BR:mlf03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      102422583 (DDB2)
SSDB
Motif
Pfam: WD40_Prp19 WD40 WD40_CDC20-Fz WD40_WDHD1_1st Beta-prop_EML_2 Beta-prop_WDR75_1st Beta-prop_RIG_2nd Beta-prop_WDR90_POC16_2nd WDR55 Beta-prop_IFT140_1st Beta-prop_EIPR1 Beta-prop_WDR19_1st EIF3I Beta-prop_TEP1_2nd WD40_RFWD3 Beta-prop_TEP1_C Beta-prop_CAF1B_HIR1 WD40_MABP1-WDR62_2nd Beta-prop_NWD2_C NBCH_WD40 Beta-prop_Vps41
Other DBs
NCBI-GeneID: 102422583
NCBI-ProteinID: XP_023612396
Ensembl: ENSMLUG00000017642
UniProt: G1PXC5
LinkDB
Position
Unknown
AA seq 427 aa
MAPKKRPETRKPLEMVVCPKSKKSRSPRELEPAAKKLCVKGPGCSRRSDSGCLRERLTSL
QVPPQCRSIVRALHHHKLGRTAWPSLQKDLQQSFLHSLASYRISQKAAPFDRRATSLTWH
PTHPSTLAVGSKGGDIMLWNLGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFFTSSMEGT
TRLQDFKGNTLRVYTSYDTCNFWFCSLDVSEKSRVVVTGDNVGNVILLNMDGRELWNLRL
HKKKVTHAALNPCCDWFLATASVDQTVKIWDLRQVKGKSSFLYSLPHSHPVNAAHFSPDG
AQLLTTDQKSEIRVYSASQWDSPPSLIPHPHRHFQHLTPIKASWHPRYNLIVVGRYPDPN
FKSCFPHELRTIDVFDGSSGKLMHQLYDSESSGIISLNEFNPMGDTLASLMGYHVLIWSQ
EKAGIWK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcccccaagaaacgcccagagacccggaagcccctcgagatggtggtgtgccccaag
agcaagaagagcaggagcccccgggagctggagcccgcggccaagaagctctgtgtgaag
ggccccggttgtagcagaagatctgactcaggctgccttagggagaggttgactagcctg
caggtcccaccacaatgcaggagcatcgtcagggccctccatcaccacaagctgggcaga
accgcctggccatctctacagaaggatctccagcagtcctttttgcactctctggcttct
taccggatatcccaaaaggctgccccttttgacaggagggccacatccttgacatggcac
ccaactcaccccagcaccctggccgtgggttccaaagggggagatatcatgctctggaac
ttgggcataaaggacaagcccaccttcattaaagggattggagctggaggcagcatcact
gggctgaagtttaaccctctcaataccaaccagtttttcacctcctcaatggagggaaca
actaggctacaagactttaaaggcaacactctccgagtttataccagctatgacacctgc
aacttctggttttgcagcctggatgtgtccgagaaaagccgagtggtggtcacaggagac
aatgtggggaacgtgatcctgctgaacatggacggcagggagctttggaatctgagattg
cacaaaaagaaagtgacccatgcggccctgaacccatgctgtgattggttcctggccacg
gcctctgtagatcaaacagtgaaaatctgggacctgcgccaggttaaagggaaatccagc
ttcctctactcactgccacacagtcatcctgtcaacgcagctcatttcagtcctgatgga
gcccagctcctgaccaccgaccagaagagtgagatccgggtttactctgcctcccagtgg
gacagccccccaagcctgatcccacatcctcaccgccacttccagcacctgacacccatc
aaggcatcctggcatccacggtacaacctcattgttgtgggcagatacccagatcctaat
ttcaaaagttgtttcccccatgaattaaggacaatcgatgtgtttgatggaagctcaggg
aagttgatgcatcagctctatgactcagaatcttctggtatcatttcgctcaatgagttc
aatcctatgggggacacactggcctctctgatgggttatcacgttctcatttggagccag
gagaaagctgggatatggaaatga

DBGET integrated database retrieval system