Myotis lucifugus (little brown bat): 102422744 Help Entry 102422744         CDS       T07795                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf03272   Virion - Hepatitis viruses mlf04382   Cornified envelope formation mlf04514   Cell adhesion molecule (CAM) interaction mlf04530   Tight junction mlf04670   Leukocyte transendothelial migration mlf05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mlf00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102422744 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     102422744 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102422744 (CLDN1)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102422744 (CLDN1)   09158 Development and regeneration    04382 Cornified envelope formation     102422744 (CLDN1)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102422744 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mlf03037]     102422744 (CLDN1)    04147 Exosome [BR:mlf04147]     102422744 (CLDN1) Cilium and associated proteins [BR:mlf03037]  Other cilia and associated proteins   Stereociliary proteins    102422744 (CLDN1) Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102422744 (CLDN1)   Exosomal proteins of colorectal cancer cells    102422744 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Cytochrom_B_C CD20 SUR7 DUF4064 DUF898 FtsX Mpo1-like OppC_N DUF6594 DUF2207_C DUF4131 DUF6232 DUF6479 MamI Motif Other DBs NCBI-GeneID:  102422744 NCBI-ProteinID:  XP_006084837 Ensembl:  ENSMLUG00000015642 LinkDB All DBs Position Unknown AA seq 185 aa AA seqDB search MPQMERFTSYAGDNIVTAQSIYEGLWMSCVSQSTGQIQCKVYDSLLNLNSTLQATRALMV VCILLGLIAIFVATVGMKCMKCLEDDEVQKMRMAIIGGVIFLIAGLAALVATAWYGHRIV QEFYDPMTPVNARYEFGAALFTGWAAASLCLLGGALLCCSCPRKTSYPTPRPYPKPAPSS GKDYV NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atgccccaaatggaaaggttcacttcttatgcgggcgacaacatcgtgacagcccagtcc atctacgaggggctgtggatgtcctgcgtgtcgcagagtaccgggcagatccagtgcaaa gtctacgactccttgctgaacctgaacagcactttgcaagcaacccgtgccttgatggtg gtttgcatcctgctgggactaatagctatctttgtggccactgttggcatgaagtgtatg aagtgcctggaggatgatgaggtccagaagatgcggatggctatcattggaggcgtgata tttcttattgcaggtctagctgctttagttgccacagcatggtatggccacagaattgtt caagaattctatgatcccatgacaccagtcaatgccaggtatgaatttggtgcggctctc ttcactggctgggctgctgcttctctctgccttctgggaggtgccctactttgctgctcc tgcccccgaaaaacatcttacccaacaccacggccctatcccaagcctgcaccttccagt gggaaagactacgtgtga

DBGET integrated database retrieval system