Myotis lucifugus (little brown bat): 102424873 Help Entry 102424873         CDS       T07795                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04015   Rap1 signaling pathway mlf04810   Regulation of actin cytoskeleton mlf05014   Amyotrophic lateral sclerosis mlf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102424873 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102424873 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102424873 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102424873 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102424873 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mlf04812]     102424873 (PFN4)    04147 Exosome [BR:mlf04147]     102424873 (PFN4) Membrane trafficking [BR:mlf04131]  Others   Actin-binding proteins    Others     102424873 (PFN4) Cytoskeleton proteins [BR:mlf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102424873 (PFN4) Exosome [BR:mlf04147]  Exosomal proteins   Proteins found in most exosomes    102424873 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102424873 NCBI-ProteinID:  XP_006083509 Ensembl:  ENSMLUG00000002166 UniProt:  G1NX82 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDSLLGTKHVDSAALIQLQERSLCVASPGFTVMPSDVRTLVNGFAKNPLQAR REGLYFMDKDYKCVRADEYSLYAKNENTGVIVVKTGLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagattccctcctgggcaccaagcatgtggacagc gccgccctcatccaactccaggagcggagcctgtgtgtagcatcaccagggtttactgtg atgcccagtgacgtccggacacttgtgaatggattcgccaagaaccctctgcaggcccga agagaaggactgtatttcatggacaaggactacaaatgtgtccgggcagatgagtattct ctttatgctaagaatgaaaacactggtgtgattgtcgtgaagaccggtctgtatcttctg gtggcgacttacactgagggcatgtatcccagtgtctgtgtggaagccacggagaagctg ggggaatatctaagaagaaaaggaaattga

DBGET integrated database retrieval system