Myotis lucifugus (little brown bat): 102425533 Help Entry 102425533         CDS       T07795                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04814   Motor proteins mlf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlf00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102425533  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102425533  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mlf03037]     102425533    04812 Cytoskeleton proteins [BR:mlf04812]     102425533 Cilium and associated proteins [BR:mlf03037]  Motile cilia and associated proteins   Dynein arm    102425533 Cytoskeleton proteins [BR:mlf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102425533 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  102425533 NCBI-ProteinID:  XP_006107040 Ensembl:  ENSMLUG00000027236 UniProt:  G1QEA5 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MEDYQAAEETTFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCIIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggctgcggaagagaccacttttgttgttgacgaagtgagcaacatt gtgaaagaggctatagaaagtgccatcggtggcaacgcctatcagcacagcaaagtcaat cagtggaccacaaatgtcgtggaacaaactttaagccaactcaccaagctgggaaaacca ttcaaatacattgtgacctgtataattatgcagaagaacggagcgggactacacacggcg agttcttgcttctgggacagctctactgacgggagctgcaccgtgcgatgggagaataag accatgtactgcatcgtcagcgccttcggactgtccatctga

DBGET integrated database retrieval system