Myotis lucifugus (little brown bat): 102425536 Help Entry 102425536         CDS       T07795                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04621   NOD-like receptor signaling pathway mlf05012   Parkinson disease mlf05132   Salmonella infection mlf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102425536  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102425536   09164 Neurodegenerative disease    05012 Parkinson disease     102425536   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102425536  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mlf03110]     102425536 Chaperones and folding catalysts [BR:mlf03110]  Protein folding catalysts   Protein disulfide isomerase    102425536 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_9 Glutaredoxin AhpC-TSA Thioredoxin_2 Thioredoxin_7 Redoxin Motif Other DBs NCBI-GeneID:  102425536 NCBI-ProteinID:  XP_014310822 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MVKQIQSKDAAQEALNSAGGKLVTVDFSTTWCGPCTMIKPFLHDVAAEYKVKCMATFQLF KKVQKMGEFSGANKE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatccagagcaaggatgctgctcaggaagccttgaacagtgcaggaggt aaacttgtaacagttgacttttccaccacgtggtgtgggccttgcacaatgatcaagccc ttccttcatgatgttgctgcagagtataaagttaaatgcatggcaaccttccagttgttt aaaaaagtacaaaagatgggtgagttttctggagctaataaggaataa

DBGET integrated database retrieval system