Myotis lucifugus (little brown bat): 102425640 Help Entry 102425640         CDS       T07795                                  Symbol ELOB Name (RefSeq) LOW QUALITY PROTEIN: elongin-B   KO K03873   elongin-B Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04066   HIF-1 signaling pathway mlf04120   Ubiquitin mediated proteolysis mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mlf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     102425640 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     102425640 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102425640 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     102425640 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102425640 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mlf04121]     102425640 (ELOB)    03400 DNA repair and recombination proteins [BR:mlf03400]     102425640 (ELOB) Ubiquitin system [BR:mlf04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      102425640 (ELOB)    Cul5 complex      102425640 (ELOB) DNA repair and recombination proteins [BR:mlf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      102425640 (ELOB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  102425640 NCBI-ProteinID:  XP_023603369 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MPAVTSCNNRPRTCFLMIPGAPRATIFPGTPKESSTGFELERHRXGHFSRRPPDEQRLYK DDQLLDDSKTLGECGFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQ DSGSSANEQAVQ NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgcccgcagtcacctcctgcaacaaccgaccaaggacgtgtttccttatgattccgggg gccccaagggccaccatctttcccgggacgcccaaggagtcgagcaccgggttcgagctg gaacgccatcgttgagggcatttttcaaggaggccgcccgacgagcagcggctgtacaag gatgaccaacttctggatgacagcaagaccctgggcgagtgtggcttcaccagtcaaaca gcgaggccccaggccccagccactgtggggctggccttccgggcagatgatgcatttgaa gctctgcgcattgagcccttctccagccctccagagctgcccgacgtgatgaagccacag gactcaggaagcagtgccaatgaacaagccgtgcagtga

DBGET integrated database retrieval system