Myotis lucifugus (little brown bat): 102426371 Help Entry 102426371         CDS       T07795                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04014   Ras signaling pathway mlf04072   Phospholipase D signaling pathway mlf04144   Endocytosis mlf04517   IgSF CAM signaling mlf04666   Fc gamma R-mediated phagocytosis mlf05132   Salmonella infection mlf05135   Yersinia infection Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102426371 (ARF6)    04072 Phospholipase D signaling pathway     102426371 (ARF6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102426371 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102426371 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     102426371 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102426371 (ARF6)    05135 Yersinia infection     102426371 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102426371 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102426371 (ARF6)    04031 GTP-binding proteins [BR:mlf04031]     102426371 (ARF6) Membrane trafficking [BR:mlf04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     102426371 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     102426371 (ARF6) Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102426371 (ARF6)   Exosomal proteins of colorectal cancer cells    102426371 (ARF6) GTP-binding proteins [BR:mlf04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     102426371 (ARF6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  102426371 NCBI-ProteinID:  XP_006107417 Ensembl:  ENSMLUG00000010869 UniProt:  G1PGW7 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgctgggc ctggacgcggccggcaagacgacaatcctgtacaagttgaagctgggccagtcggtgacc accatccccaccgtggggttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggcctgatcttcgtggtggactgtgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcatcatcaatgaccgggagatgagggacgccatcatcctcatcttc gccaacaagcaggacctgcccgatgccatgaagccccacgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgcgccacctcgggggac ggactctacgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system