Myotis lucifugus (little brown bat): 102426634 Help Entry 102426634         CDS       T07795                                  Symbol FGF3 Name (RefSeq) fibroblast growth factor 3   KO K04358   fibroblast growth factor Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04010   MAPK signaling pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04020   Calcium signaling pathway mlf04151   PI3K-Akt signaling pathway mlf04810   Regulation of actin cytoskeleton mlf05200   Pathways in cancer mlf05207   Chemical carcinogenesis - receptor activation mlf05218   Melanoma mlf05224   Breast cancer mlf05226   Gastric cancer Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102426634 (FGF3)    04014 Ras signaling pathway     102426634 (FGF3)    04015 Rap1 signaling pathway     102426634 (FGF3)    04020 Calcium signaling pathway     102426634 (FGF3)    04151 PI3K-Akt signaling pathway     102426634 (FGF3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102426634 (FGF3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102426634 (FGF3)    05207 Chemical carcinogenesis - receptor activation     102426634 (FGF3)   09162 Cancer: specific types    05226 Gastric cancer     102426634 (FGF3)    05218 Melanoma     102426634 (FGF3)    05224 Breast cancer     102426634 (FGF3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102426634 (FGF3)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102426634 (FGF3) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Growth factors (RTK binding)    102426634 (FGF3) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Growth factors/receptors    102426634 (FGF3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Dehalogenase Motif Other DBs NCBI-GeneID:  102426634 NCBI-ProteinID:  XP_023617581 LinkDB All DBs Position Unknown AA seq 167 aa AA seqDB search MSALLPPTPPTPGILEITAVEVGIVAIKGLFSGRYLAMNKRGRLYASENYNAECEFVERI HELGYNTYASRLYRTVPSGSGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPR VLDHKDHEMVRLLQSGAGLHGGLARPPGKATQPQRRRQRQRSRGGLA NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atgtcagctttgttaccccccacgccccccactccaggtattctagagataacggcagtg gaggtgggcatcgtggccatcaaggggctcttctccgggcggtacctggccatgaacaag aggggacggctctacgcatcggagaactacaacgcggagtgcgagtttgtggagcggatc catgagctgggctataacacgtatgcctcccggctctaccggacggtgcccagtgggtcg ggggcccggcgccagcccagcgccgagagactgtggtatgtgtcggtcaacggcaagggc cggccccgcaggggcttcaagacgcgccgcacacagaagtcctcactgttcctgccccgc gtgctcgaccacaaggaccacgagatggtgcggctgctccagagcggggccgggctccat ggcggcctggccaggccacctggcaaggccacccagccccagcggcggcgacagcggcag aggagccggggaggcctcgcttag

DBGET integrated database retrieval system