Myotis lucifugus (little brown bat): 102426867 Help Entry 102426867         CDS       T07795                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha   KO K04383   interleukin 1 alpha Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04010   MAPK signaling pathway mlf04060   Cytokine-cytokine receptor interaction mlf04217   Necroptosis mlf04218   Cellular senescence mlf04380   Osteoclast differentiation mlf04640   Hematopoietic cell lineage mlf04932   Non-alcoholic fatty liver disease mlf04933   AGE-RAGE signaling pathway in diabetic complications mlf04940   Type I diabetes mellitus mlf05010   Alzheimer disease mlf05020   Prion disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05133   Pertussis mlf05140   Leishmaniasis mlf05152   Tuberculosis mlf05162   Measles mlf05164   Influenza A mlf05321   Inflammatory bowel disease mlf05323   Rheumatoid arthritis mlf05332   Graft-versus-host disease mlf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102426867 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102426867 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102426867 (IL1A)    04218 Cellular senescence     102426867 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102426867 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     102426867 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102426867 (IL1A)    05162 Measles     102426867 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     102426867 (IL1A)    05152 Tuberculosis     102426867 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102426867 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     102426867 (IL1A)    05321 Inflammatory bowel disease     102426867 (IL1A)    05332 Graft-versus-host disease     102426867 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     102426867 (IL1A)    05020 Prion disease     102426867 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     102426867 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102426867 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102426867 (IL1A)    04932 Non-alcoholic fatty liver disease     102426867 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     102426867 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102426867 (IL1A) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    102426867 (IL1A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 DUF3958 Motif Other DBs NCBI-GeneID:  102426867 NCBI-ProteinID:  XP_006103068 Ensembl:  ENSMLUG00000000166 UniProt:  G1NSN5 LinkDB All DBs Position Unknown AA seq 269 aa AA seqDB search MAQVPDLFEDLKSCYSENEEYSSEIDQLSLNQKSFYDASYDPFPKNCMGQFLSLSTSETS KTSQLTYKESVVVVAANGKILKKRRLSFNQFITDDDLETIANDPEEEILQPTSVPYSFQG NVKYPFMRVIKRHFILNDNLHQSIIRDTSGRFLMAATLNNMDQAVRFDMGAYKSDDLKRP VTLRISDTRLFLSAQNEGEPVLLKELPETPKIITDETNLLFFWESQGSKDYFESVAHPKL FIATKQEYQVHMASGHPSIIDLQILENYA NT seq 810 nt NT seq  +upstreamnt  +downstreamnt atggctcaggtccctgacctctttgaagacctgaagagctgctacagtgaaaatgaagaa tacagttccgaaattgaccaactctctctgaatcagaaatccttctatgatgcaagctac gacccatttcccaagaactgcatgggccaattcctatctctgagtacctctgagacctct aagacatcccagcttacctacaaggagagtgtggtggtggtggcggccaatgggaagatt ctgaagaagagacggttgagtttcaatcagttcattaccgatgatgacctggaaaccatt gccaatgatccagaagaagaaatcctccagcccacgtcagtaccttacagcttccagggc aacgtgaagtaccccttcatgagggtcatcaaaaggcatttcatcctgaatgacaacctc caccaaagcatcattcgagacacatcaggccgcttcctcatggccgccacgttaaataat atggaccaagcagtgagatttgacatgggtgcttataaatcagatgaccttaaacgtcct gtaactctgagaatctcagacacgcgactgtttctgagtgcgcaaaatgaaggcgaaccc gtattgctaaaggagttgcctgagacacccaaaatcatcacagatgagaccaacctcctc ttcttctgggaatctcagggcagtaaggactacttcgagtcagttgcccatccaaagctg tttattgccacaaagcaagaataccaggtgcacatggcaagtgggcatccctctatcatt gacttgcagatactggaaaactacgcttaa

DBGET integrated database retrieval system