Myotis lucifugus (little brown bat): 102427189 Help Entry 102427189         CDS       T07795                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01523   Antifolate resistance mlf04010   MAPK signaling pathway mlf04060   Cytokine-cytokine receptor interaction mlf04064   NF-kappa B signaling pathway mlf04217   Necroptosis mlf04380   Osteoclast differentiation mlf04620   Toll-like receptor signaling pathway mlf04621   NOD-like receptor signaling pathway mlf04623   Cytosolic DNA-sensing pathway mlf04625   C-type lectin receptor signaling pathway mlf04640   Hematopoietic cell lineage mlf04657   IL-17 signaling pathway mlf04659   Th17 cell differentiation mlf04668   TNF signaling pathway mlf04750   Inflammatory mediator regulation of TRP channels mlf04932   Non-alcoholic fatty liver disease mlf04933   AGE-RAGE signaling pathway in diabetic complications mlf04936   Alcoholic liver disease mlf04940   Type I diabetes mellitus mlf05010   Alzheimer disease mlf05020   Prion disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05132   Salmonella infection mlf05133   Pertussis mlf05134   Legionellosis mlf05135   Yersinia infection mlf05140   Leishmaniasis mlf05142   Chagas disease mlf05143   African trypanosomiasis mlf05144   Malaria mlf05146   Amoebiasis mlf05152   Tuberculosis mlf05162   Measles mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05168   Herpes simplex virus 1 infection mlf05171   Coronavirus disease - COVID-19 mlf05321   Inflammatory bowel disease mlf05323   Rheumatoid arthritis mlf05332   Graft-versus-host disease mlf05417   Lipid and atherosclerosis mlf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102427189 (IL1B)    04064 NF-kappa B signaling pathway     102427189 (IL1B)    04668 TNF signaling pathway     102427189 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102427189 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102427189 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102427189 (IL1B)    04620 Toll-like receptor signaling pathway     102427189 (IL1B)    04621 NOD-like receptor signaling pathway     102427189 (IL1B)    04623 Cytosolic DNA-sensing pathway     102427189 (IL1B)    04625 C-type lectin receptor signaling pathway     102427189 (IL1B)    04659 Th17 cell differentiation     102427189 (IL1B)    04657 IL-17 signaling pathway     102427189 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102427189 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     102427189 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102427189 (IL1B)    05164 Influenza A     102427189 (IL1B)    05162 Measles     102427189 (IL1B)    05168 Herpes simplex virus 1 infection     102427189 (IL1B)    05163 Human cytomegalovirus infection     102427189 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     102427189 (IL1B)    05135 Yersinia infection     102427189 (IL1B)    05133 Pertussis     102427189 (IL1B)    05134 Legionellosis     102427189 (IL1B)    05152 Tuberculosis     102427189 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     102427189 (IL1B)    05144 Malaria     102427189 (IL1B)    05140 Leishmaniasis     102427189 (IL1B)    05142 Chagas disease     102427189 (IL1B)    05143 African trypanosomiasis     102427189 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     102427189 (IL1B)    05321 Inflammatory bowel disease     102427189 (IL1B)    05332 Graft-versus-host disease     102427189 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102427189 (IL1B)    05020 Prion disease     102427189 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     102427189 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102427189 (IL1B)    05418 Fluid shear stress and atherosclerosis     102427189 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102427189 (IL1B)    04936 Alcoholic liver disease     102427189 (IL1B)    04932 Non-alcoholic fatty liver disease     102427189 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     102427189 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     102427189 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102427189 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102427189 (IL1B) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    102427189 (IL1B) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Cytokines    102427189 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1_propep IL1 Motif Other DBs NCBI-GeneID:  102427189 NCBI-ProteinID:  XP_006103069 Ensembl:  ENSMLUG00000009941 UniProt:  G1PEV6 LinkDB All DBs Position Unknown AA seq 268 aa AA seqDB search MAAVPELANEVMAYYSDDENGLFFEADGPQQTKCSFQDLDLSPLGDGSIQLKVSQQLYNS SFRRAVSVVIAVEKLRKVHMVCPQDFQDDDLRSLFFFIFKEESIDCMWDGSYECDASLQS LHCRLRDINQKSLVLSGPHELQALHLNGEDVNQQVVFCMSFVPGDENIDKIPVALGIKEK NLYLSCVVKDKKPTLQLETFDPHGQSKKKIDRRFIFHKKEIRDKVEFESAMYPNWYISTS QADQTPVFLGSTKGGQDITDFTMEILTH NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtgcctgaactcgccaatgaagtgatggcttactacagtgacgatgagaat ggcctgttctttgaggctgatggcccacaacagactaagtgctccttccaagacctggac ctcagccctctgggagatgggagcatccagctgaaagtctcccagcagctctacaactcc agcttcaggcgggccgtgtcggtcgtcattgccgtggagaagctgaggaaagtgcacatg gtctgcccacaggacttccaggatgacgacctgcggagcctcttcttcttcatctttaaa gaagaatccatcgactgcatgtgggatggcagttacgagtgtgatgcatccctacaatcg ctgcactgcaggctccgggacatcaaccaaaaatccctggtgctgtctggaccacatgag ctgcaggctcttcacctgaatggagaggatgtgaaccaacaagtggtgttctgcatgagc ttcgtgccaggagacgagaatatcgacaagatacccgtggccttgggtatcaaggaaaag aacctgtacctgtcttgcgtggtgaaggacaagaagcccaccctgcagctggagacattt gacccccacggtcagtcaaagaagaagatagacaggcgatttatcttccacaagaaggaa atcagggacaaggtagaatttgagtctgccatgtaccccaactggtacatcagcacctcg caagcggaccagacgcccgtcttcctgggaagtactaagggtggccaggatataactgac ttcaccatggaaatcctgactcactga

DBGET integrated database retrieval system