Myotis lucifugus (little brown bat): 102427425 Help Entry 102427425         CDS       T07795                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04024   cAMP signaling pathway mlf04080   Neuroactive ligand-receptor interaction mlf04920   Adipocytokine signaling pathway mlf04923   Regulation of lipolysis in adipocytes mlf05034   Alcoholism Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102427425 (NPY)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102427425 (NPY)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     102427425 (NPY)    04920 Adipocytokine signaling pathway     102427425 (NPY)  09160 Human Diseases   09165 Substance dependence    05034 Alcoholism     102427425 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102427425 (NPY) Cytokines and neuropeptides [BR:mlf04052]  Neuropeptides   GPCR binding    102427425 (NPY) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  102427425 NCBI-ProteinID:  XP_006088858 Ensembl:  ENSMLUG00000004126 UniProt:  G1P1Q1 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MLGSKRLGLSRLALALSVLVCLGALTEAYPSKPEKPGENASAEELARYYSALRHYINLIT RQRYGKRSSPETLISDLLMSESTENVPRTRLEDRSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgctggggagcaagcgactgggactgtcccgcctggcgctcgccctgtccgtgctcgtg tgcctgggcgcgctgaccgaggcgtacccctccaagcccgagaagcccggggagaacgcg tctgcggaggagctggccagatactactctgcgctgcgacactacatcaacctcatcacc aggcagagatatgggaaacgatccagcccggagacactgatttcagacctcttgatgagt gaaagcacagaaaatgttcctcgaactaggctggaagaccgctctatgtggtga

DBGET integrated database retrieval system