Myotis lucifugus (little brown bat): 102427857 Help Entry 102427857         CDS       T07795                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04613   Neutrophil extracellular trap formation mlf05034   Alcoholism mlf05202   Transcriptional misregulation in cancer mlf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102427857  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102427857   09163 Immune disease    05322 Systemic lupus erythematosus     102427857   09165 Substance dependence    05034 Alcoholism     102427857  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlf03036]     102427857   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102427857 Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102427857 Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102427857 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  102427857 NCBI-ProteinID:  XP_006091951 Ensembl:  ENSMLUG00000025054 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFRTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgcaaatccacgggtgggaaagcgccccgcaaacag ctggccactaaagctgccaggaaaagtgccccctctaccggcggggtgaagaagccccat cgctacaggcccgggaccgttgcgcttcgagaaatccgtcgttaccagaaatcgaccgag cttctgatccggaagctgcctttccagaggttggtgagggagatcgcccaggatttcaga accgacctgaggtttcaaagtgcagccatcggtgcgctgcaggaggctagcgaagcgtac ctggtgggtctatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system