Myotis lucifugus (little brown bat): 102428495 Help Entry 102428495         CDS       T07795                                  Symbol CXCL8 Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04061   Viral protein interaction with cytokine and cytokine receptor mlf04062   Chemokine signaling pathway mlf04064   NF-kappa B signaling pathway mlf04072   Phospholipase D signaling pathway mlf04218   Cellular senescence mlf04620   Toll-like receptor signaling pathway mlf04621   NOD-like receptor signaling pathway mlf04622   RIG-I-like receptor signaling pathway mlf04657   IL-17 signaling pathway mlf04932   Non-alcoholic fatty liver disease mlf04933   AGE-RAGE signaling pathway in diabetic complications mlf04936   Alcoholic liver disease mlf05132   Salmonella infection mlf05133   Pertussis mlf05134   Legionellosis mlf05135   Yersinia infection mlf05142   Chagas disease mlf05144   Malaria mlf05146   Amoebiasis mlf05161   Hepatitis B mlf05163   Human cytomegalovirus infection mlf05164   Influenza A mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05171   Coronavirus disease - COVID-19 mlf05200   Pathways in cancer mlf05202   Transcriptional misregulation in cancer mlf05219   Bladder cancer mlf05323   Rheumatoid arthritis mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102428495 (CXCL8)    04072 Phospholipase D signaling pathway     102428495 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102428495 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     102428495 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102428495 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102428495 (CXCL8)    04621 NOD-like receptor signaling pathway     102428495 (CXCL8)    04622 RIG-I-like receptor signaling pathway     102428495 (CXCL8)    04657 IL-17 signaling pathway     102428495 (CXCL8)    04062 Chemokine signaling pathway     102428495 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102428495 (CXCL8)    05202 Transcriptional misregulation in cancer     102428495 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     102428495 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     102428495 (CXCL8)    05171 Coronavirus disease - COVID-19     102428495 (CXCL8)    05164 Influenza A     102428495 (CXCL8)    05163 Human cytomegalovirus infection     102428495 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     102428495 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     102428495 (CXCL8)    05135 Yersinia infection     102428495 (CXCL8)    05133 Pertussis     102428495 (CXCL8)    05134 Legionellosis     102428495 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     102428495 (CXCL8)    05144 Malaria     102428495 (CXCL8)    05142 Chagas disease     102428495 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     102428495 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102428495 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102428495 (CXCL8)    04932 Non-alcoholic fatty liver disease     102428495 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     102428495 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102428495 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102428495 (CXCL8) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Chemokines    102428495 (CXCL8) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Chemokines    102428495 (CXCL8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CholecysA-Rec_N Motif Other DBs NCBI-GeneID:  102428495 NCBI-ProteinID:  XP_014316085 Ensembl:  ENSMLUG00000004871 UniProt:  G1P3E5 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MTSKLAIALLAAFVLSAALCEASVLPIIETELRCQCIGMHSIPFHPKLIRELRVIESGPH CENSEIIVKLKNETLLCLDPEEHWVQKVVQIFLEEAENKEP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgacttccaagctggccatcgctctcctggcagcgttcgtgctttctgcagctctgtgc gaagcttcagttctgccgataatagaaacagaacttcgatgccagtgcattggtatgcac tctatacctttccaccccaagcttatcagggaactgagagtgattgagagtggaccacac tgtgaaaattcagaaatcattgtaaagttaaagaatgaaacgctgctctgcctggacccc gaggaacactgggtgcagaaggttgtgcagatatttttagaggaagctgagaataaagag ccatga

DBGET integrated database retrieval system