Myotis lucifugus (little brown bat): 102428803 Help Entry 102428803         CDS       T07795                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04010   MAPK signaling pathway mlf04020   Calcium signaling pathway mlf04022   cGMP-PKG signaling pathway mlf04114   Oocyte meiosis mlf04218   Cellular senescence mlf04310   Wnt signaling pathway mlf04360   Axon guidance mlf04370   VEGF signaling pathway mlf04380   Osteoclast differentiation mlf04625   C-type lectin receptor signaling pathway mlf04650   Natural killer cell mediated cytotoxicity mlf04658   Th1 and Th2 cell differentiation mlf04659   Th17 cell differentiation mlf04660   T cell receptor signaling pathway mlf04662   B cell receptor signaling pathway mlf04720   Long-term potentiation mlf04724   Glutamatergic synapse mlf04921   Oxytocin signaling pathway mlf04922   Glucagon signaling pathway mlf04924   Renin secretion mlf05010   Alzheimer disease mlf05014   Amyotrophic lateral sclerosis mlf05020   Prion disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05031   Amphetamine addiction mlf05152   Tuberculosis mlf05163   Human cytomegalovirus infection mlf05166   Human T-cell leukemia virus 1 infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05170   Human immunodeficiency virus 1 infection mlf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102428803 (PPP3R1)    04310 Wnt signaling pathway     102428803 (PPP3R1)    04370 VEGF signaling pathway     102428803 (PPP3R1)    04020 Calcium signaling pathway     102428803 (PPP3R1)    04022 cGMP-PKG signaling pathway     102428803 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102428803 (PPP3R1)    04218 Cellular senescence     102428803 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102428803 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     102428803 (PPP3R1)    04660 T cell receptor signaling pathway     102428803 (PPP3R1)    04658 Th1 and Th2 cell differentiation     102428803 (PPP3R1)    04659 Th17 cell differentiation     102428803 (PPP3R1)    04662 B cell receptor signaling pathway     102428803 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     102428803 (PPP3R1)    04921 Oxytocin signaling pathway     102428803 (PPP3R1)    04924 Renin secretion     102428803 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     102428803 (PPP3R1)    04720 Long-term potentiation     102428803 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     102428803 (PPP3R1)    04380 Osteoclast differentiation     102428803 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102428803 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102428803 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     102428803 (PPP3R1)    05163 Human cytomegalovirus infection     102428803 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     102428803 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     102428803 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     102428803 (PPP3R1)    05014 Amyotrophic lateral sclerosis     102428803 (PPP3R1)    05020 Prion disease     102428803 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     102428803 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     102428803 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102428803 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlf01009]     102428803 (PPP3R1) Protein phosphatases and associated proteins [BR:mlf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102428803 (PPP3R1) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg EF-hand_9 RSA-1_C Motif Other DBs NCBI-GeneID:  102428803 NCBI-ProteinID:  XP_014314883 LinkDB All DBs Position Unknown AA seq 173 aa AA seqDB search MFFKGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQR VIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLK MMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgttttttaagggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgct gatgaaattaaaaggctaggaaagagatttaagaagcttgatttggacaattctggttct ttgagtgtggaagagttcatgtctctgccggagttacaacagaatcctttagtacagcga gtaatagatatattcgacacagatgggaatggagaagtagactttaaagaattcattgaa ggagtctctcagttcagtgtcaaaggcgataaggagcagaagttgaggtttgctttccgt atctatgacatggataaagatggctatatttccaatggggaactcttccaggtgctgaag atgatggtggggaacaatctgaaagatacgcagttacagcaaattgtagacaaaaccata ataaatgcagataaggatggagatggaagaatatcctttgaagaattctgtgctgttgta ggtggcctagatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system