Myotis lucifugus (little brown bat): 102429409 Help Entry 102429409         CDS       T07795                                  Symbol GSTM3 Name (RefSeq) glutathione S-transferase Mu 3   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf00480   Glutathione metabolism mlf00980   Metabolism of xenobiotics by cytochrome P450 mlf00982   Drug metabolism - cytochrome P450 mlf00983   Drug metabolism - other enzymes mlf01100   Metabolic pathways mlf01524   Platinum drug resistance mlf05200   Pathways in cancer mlf05204   Chemical carcinogenesis - DNA adducts mlf05207   Chemical carcinogenesis - receptor activation mlf05208   Chemical carcinogenesis - reactive oxygen species mlf05225   Hepatocellular carcinoma mlf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     102429409 (GSTM3)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     102429409 (GSTM3)    00982 Drug metabolism - cytochrome P450     102429409 (GSTM3)    00983 Drug metabolism - other enzymes     102429409 (GSTM3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102429409 (GSTM3)    05204 Chemical carcinogenesis - DNA adducts     102429409 (GSTM3)    05207 Chemical carcinogenesis - receptor activation     102429409 (GSTM3)    05208 Chemical carcinogenesis - reactive oxygen species     102429409 (GSTM3)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102429409 (GSTM3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102429409 (GSTM3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102429409 (GSTM3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mlf02000]     102429409 (GSTM3) Enzymes [BR:mlf01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      102429409 (GSTM3) Transporters [BR:mlf02000]  Other transporters   Pores ion channels [TC:1]    102429409 (GSTM3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_N GST_C_3 GST_N_3 GST_N_2 GST_C_6 Motif Other DBs NCBI-GeneID:  102429409 NCBI-ProteinID:  XP_006092637 Ensembl:  ENSMLUG00000004393 LinkDB All DBs Position Unknown AA seq 225 aa AA seqDB search MSCSKSMVLGYWDIRGLAHAIRLLLEFTGTCYEEKRYTCGGAPDFDKSQWLDVKFKLDLD FPNLPYLMDGKNKITQSNAILRYIARKHNMCGDTEEEKIRVDIMENQIMDFRMQLVRICY NSDHEKLKPQYLEQLPGQLKQFSLFLGKFSWFAGEKLTFVDFLTYDVLDQNRMFEPKCLD EFPNLKAFMCRFEALEKIAAYMQSDRFFKMPVNNKMALWGCKRIC NT seq 678 nt NT seq  +upstreamnt  +downstreamnt atgtcgtgctctaagtccatggtcctcgggtactgggatatccgcgggctggcgcacgcc atccgcctgctcctggagttcaccggcacctgctacgaggagaaacggtacacctgcggg ggagctcctgactttgataaaagccaatggctggacgtgaaattcaagctggacctggac tttcccaacctgccctacctcatggacggcaagaacaagatcacccagagcaacgccatc ttgcgctacatcgcacgcaagcacaacatgtgtggggatactgaagaagaaaagatccgc gtggacatcatggagaaccagatcatggatttccgcatgcagctggttcgaatctgctac aactcggaccatgaaaagctgaagccccagtacttggaacagctccctggacaactgaaa cagttctccctgttcctggggaaattctcgtggtttgcaggggaaaagctcacctttgtg gatttcctcacctacgatgtcttggatcagaaccgtatgtttgagcccaagtgcctggat gaatttccaaacctgaaggctttcatgtgccgttttgaggctttggagaagatcgcagcc tacatgcagtctgaccgcttcttcaagatgcccgtcaacaacaagatggccctgtggggc tgcaagagaatatgctaa

DBGET integrated database retrieval system