Myotis lucifugus (little brown bat): 102430737 Help Entry 102430737         CDS       T07795                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04010   MAPK signaling pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04022   cGMP-PKG signaling pathway mlf04066   HIF-1 signaling pathway mlf04068   FoxO signaling pathway mlf04072   Phospholipase D signaling pathway mlf04081   Hormone signaling mlf04114   Oocyte meiosis mlf04140   Autophagy - animal mlf04150   mTOR signaling pathway mlf04151   PI3K-Akt signaling pathway mlf04152   AMPK signaling pathway mlf04211   Longevity regulating pathway mlf04213   Longevity regulating pathway - multiple species mlf04810   Regulation of actin cytoskeleton mlf04910   Insulin signaling pathway mlf04911   Insulin secretion mlf04913   Ovarian steroidogenesis mlf04914   Progesterone-mediated oocyte maturation mlf04917   Prolactin signaling pathway mlf04923   Regulation of lipolysis in adipocytes mlf04930   Type II diabetes mellitus mlf04931   Insulin resistance mlf04932   Non-alcoholic fatty liver disease mlf04940   Type I diabetes mellitus mlf04950   Maturity onset diabetes of the young mlf04960   Aldosterone-regulated sodium reabsorption mlf05010   Alzheimer disease mlf05215   Prostate cancer mlf05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102430737 (INS)    04015 Rap1 signaling pathway     102430737 (INS)    04066 HIF-1 signaling pathway     102430737 (INS)    04068 FoxO signaling pathway     102430737 (INS)    04072 Phospholipase D signaling pathway     102430737 (INS)    04022 cGMP-PKG signaling pathway     102430737 (INS)    04151 PI3K-Akt signaling pathway     102430737 (INS)    04152 AMPK signaling pathway     102430737 (INS)    04150 mTOR signaling pathway     102430737 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     102430737 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102430737 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     102430737 (INS)    04923 Regulation of lipolysis in adipocytes     102430737 (INS)    04913 Ovarian steroidogenesis     102430737 (INS)    04917 Prolactin signaling pathway     102430737 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102430737 (INS)   09149 Aging    04211 Longevity regulating pathway     102430737 (INS)    04213 Longevity regulating pathway - multiple species     102430737 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     102430737 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102430737 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     102430737 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102430737 (INS)    04940 Type I diabetes mellitus     102430737 (INS)    04950 Maturity onset diabetes of the young     102430737 (INS)    04932 Non-alcoholic fatty liver disease     102430737 (INS)    04931 Insulin resistance     102430737 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102430737 (INS) Cytokines and neuropeptides [BR:mlf04052]  Neuropeptides   Unclassified    102430737 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  102430737 NCBI-ProteinID:  XP_006109582 Ensembl:  ENSMLUG00000003871 UniProt:  G1P146 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MALWTRLLPLLALLALWAPAPAQAFNHEHLCGEDLVDIMTIICGDQGFKNPKAARELPDP QEGEVDMGAGGPKALTVEELLQNTDIVEVCCTNICSFYDMETYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacgcgcctcctgcccctgctcgccctgctggccctctgggcgcccgcc cccgcccaggccttcaatcacgagcacctgtgtggcgaggatttggtggatatcatgacc ataatatgtggagatcagggcttcaaaaatcccaaggccgcccgggagctgcccgacccg caggagggggaggtggacatgggcgcaggtggcccaaaggccctcaccgtggaggagctc ctgcagaacactgacatcgtggaggtgtgctgcaccaacatctgctccttctatgatatg gagacctactgcaactag

DBGET integrated database retrieval system