Myotis lucifugus (little brown bat): 102430744 Help Entry 102430744         CDS       T07795                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01521   EGFR tyrosine kinase inhibitor resistance mlf01522   Endocrine resistance mlf04010   MAPK signaling pathway mlf04012   ErbB signaling pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04062   Chemokine signaling pathway mlf04068   FoxO signaling pathway mlf04071   Sphingolipid signaling pathway mlf04072   Phospholipase D signaling pathway mlf04137   Mitophagy - animal mlf04140   Autophagy - animal mlf04150   mTOR signaling pathway mlf04151   PI3K-Akt signaling pathway mlf04210   Apoptosis mlf04211   Longevity regulating pathway mlf04213   Longevity regulating pathway - multiple species mlf04218   Cellular senescence mlf04360   Axon guidance mlf04370   VEGF signaling pathway mlf04371   Apelin signaling pathway mlf04540   Gap junction mlf04550   Signaling pathways regulating pluripotency of stem cells mlf04625   C-type lectin receptor signaling pathway mlf04650   Natural killer cell mediated cytotoxicity mlf04660   T cell receptor signaling pathway mlf04662   B cell receptor signaling pathway mlf04664   Fc epsilon RI signaling pathway mlf04714   Thermogenesis mlf04720   Long-term potentiation mlf04722   Neurotrophin signaling pathway mlf04725   Cholinergic synapse mlf04726   Serotonergic synapse mlf04730   Long-term depression mlf04810   Regulation of actin cytoskeleton mlf04910   Insulin signaling pathway mlf04912   GnRH signaling pathway mlf04915   Estrogen signaling pathway mlf04916   Melanogenesis mlf04917   Prolactin signaling pathway mlf04919   Thyroid hormone signaling pathway mlf04921   Oxytocin signaling pathway mlf04926   Relaxin signaling pathway mlf04929   GnRH secretion mlf04933   AGE-RAGE signaling pathway in diabetic complications mlf04935   Growth hormone synthesis, secretion and action mlf05010   Alzheimer disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05034   Alcoholism mlf05160   Hepatitis C mlf05161   Hepatitis B mlf05163   Human cytomegalovirus infection mlf05165   Human papillomavirus infection mlf05166   Human T-cell leukemia virus 1 infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05203   Viral carcinogenesis mlf05205   Proteoglycans in cancer mlf05206   MicroRNAs in cancer mlf05207   Chemical carcinogenesis - receptor activation mlf05208   Chemical carcinogenesis - reactive oxygen species mlf05210   Colorectal cancer mlf05211   Renal cell carcinoma mlf05213   Endometrial cancer mlf05214   Glioma mlf05215   Prostate cancer mlf05216   Thyroid cancer mlf05218   Melanoma mlf05219   Bladder cancer mlf05220   Chronic myeloid leukemia mlf05221   Acute myeloid leukemia mlf05223   Non-small cell lung cancer mlf05224   Breast cancer mlf05225   Hepatocellular carcinoma mlf05226   Gastric cancer mlf05230   Central carbon metabolism in cancer mlf05231   Choline metabolism in cancer mlf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102430744 (NRAS)    04012 ErbB signaling pathway     102430744 (NRAS)    04014 Ras signaling pathway     102430744 (NRAS)    04015 Rap1 signaling pathway     102430744 (NRAS)    04370 VEGF signaling pathway     102430744 (NRAS)    04371 Apelin signaling pathway     102430744 (NRAS)    04068 FoxO signaling pathway     102430744 (NRAS)    04072 Phospholipase D signaling pathway     102430744 (NRAS)    04071 Sphingolipid signaling pathway     102430744 (NRAS)    04151 PI3K-Akt signaling pathway     102430744 (NRAS)    04150 mTOR signaling pathway     102430744 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102430744 (NRAS)    04137 Mitophagy - animal     102430744 (NRAS)   09143 Cell growth and death    04210 Apoptosis     102430744 (NRAS)    04218 Cellular senescence     102430744 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102430744 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102430744 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102430744 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102430744 (NRAS)    04650 Natural killer cell mediated cytotoxicity     102430744 (NRAS)    04660 T cell receptor signaling pathway     102430744 (NRAS)    04662 B cell receptor signaling pathway     102430744 (NRAS)    04664 Fc epsilon RI signaling pathway     102430744 (NRAS)    04062 Chemokine signaling pathway     102430744 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102430744 (NRAS)    04929 GnRH secretion     102430744 (NRAS)    04912 GnRH signaling pathway     102430744 (NRAS)    04915 Estrogen signaling pathway     102430744 (NRAS)    04917 Prolactin signaling pathway     102430744 (NRAS)    04921 Oxytocin signaling pathway     102430744 (NRAS)    04926 Relaxin signaling pathway     102430744 (NRAS)    04935 Growth hormone synthesis, secretion and action     102430744 (NRAS)    04919 Thyroid hormone signaling pathway     102430744 (NRAS)    04916 Melanogenesis     102430744 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     102430744 (NRAS)    04726 Serotonergic synapse     102430744 (NRAS)    04720 Long-term potentiation     102430744 (NRAS)    04730 Long-term depression     102430744 (NRAS)    04722 Neurotrophin signaling pathway     102430744 (NRAS)   09158 Development and regeneration    04360 Axon guidance     102430744 (NRAS)   09149 Aging    04211 Longevity regulating pathway     102430744 (NRAS)    04213 Longevity regulating pathway - multiple species     102430744 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     102430744 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102430744 (NRAS)    05206 MicroRNAs in cancer     102430744 (NRAS)    05205 Proteoglycans in cancer     102430744 (NRAS)    05207 Chemical carcinogenesis - receptor activation     102430744 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     102430744 (NRAS)    05203 Viral carcinogenesis     102430744 (NRAS)    05230 Central carbon metabolism in cancer     102430744 (NRAS)    05231 Choline metabolism in cancer     102430744 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102430744 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102430744 (NRAS)    05225 Hepatocellular carcinoma     102430744 (NRAS)    05226 Gastric cancer     102430744 (NRAS)    05214 Glioma     102430744 (NRAS)    05216 Thyroid cancer     102430744 (NRAS)    05221 Acute myeloid leukemia     102430744 (NRAS)    05220 Chronic myeloid leukemia     102430744 (NRAS)    05218 Melanoma     102430744 (NRAS)    05211 Renal cell carcinoma     102430744 (NRAS)    05219 Bladder cancer     102430744 (NRAS)    05215 Prostate cancer     102430744 (NRAS)    05213 Endometrial cancer     102430744 (NRAS)    05224 Breast cancer     102430744 (NRAS)    05223 Non-small cell lung cancer     102430744 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102430744 (NRAS)    05170 Human immunodeficiency virus 1 infection     102430744 (NRAS)    05161 Hepatitis B     102430744 (NRAS)    05160 Hepatitis C     102430744 (NRAS)    05163 Human cytomegalovirus infection     102430744 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102430744 (NRAS)    05165 Human papillomavirus infection     102430744 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102430744 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     102430744 (NRAS)   09165 Substance dependence    05034 Alcoholism     102430744 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102430744 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102430744 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102430744 (NRAS)    01522 Endocrine resistance     102430744 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102430744 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102430744 (NRAS)    04031 GTP-binding proteins [BR:mlf04031]     102430744 (NRAS) Membrane trafficking [BR:mlf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102430744 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102430744 (NRAS) Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102430744 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    102430744 (NRAS)   Exosomal proteins of breast cancer cells    102430744 (NRAS)   Exosomal proteins of colorectal cancer cells    102430744 (NRAS) GTP-binding proteins [BR:mlf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102430744 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  102430744 NCBI-ProteinID:  XP_006092546 Ensembl:  ENSMLUG00000022354 UniProt:  G1QCG3 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctattggatatactggatacagctgga caagaggagtacagtgctatgagggaccaatacatgaggacaggggaaggcttcctctgt gtattcgccatcaataatagcaagtcatttgcagatattaacctctacagggaacagatt aagcgagtgaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacggttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactagta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggttgccttgtgtggtgatgtaa

DBGET integrated database retrieval system