Myotis lucifugus (little brown bat): 102430773 Help Entry 102430773         CDS       T07795                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04630   JAK-STAT signaling pathway mlf04640   Hematopoietic cell lineage mlf04657   IL-17 signaling pathway mlf04658   Th1 and Th2 cell differentiation mlf04660   T cell receptor signaling pathway mlf04664   Fc epsilon RI signaling pathway mlf04672   Intestinal immune network for IgA production mlf05200   Pathways in cancer mlf05310   Asthma mlf05320   Autoimmune thyroid disease mlf05321   Inflammatory bowel disease mlf05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102430773 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102430773 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102430773 (IL5)    04660 T cell receptor signaling pathway     102430773 (IL5)    04658 Th1 and Th2 cell differentiation     102430773 (IL5)    04657 IL-17 signaling pathway     102430773 (IL5)    04664 Fc epsilon RI signaling pathway     102430773 (IL5)    04672 Intestinal immune network for IgA production     102430773 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102430773 (IL5)   09163 Immune disease    05310 Asthma     102430773 (IL5)    05320 Autoimmune thyroid disease     102430773 (IL5)    05321 Inflammatory bowel disease     102430773 (IL5)    05330 Allograft rejection     102430773 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102430773 (IL5)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102430773 (IL5) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    102430773 (IL5) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Cytokines    102430773 (IL5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  102430773 NCBI-ProteinID:  XP_023619559 Ensembl:  ENSMLUG00000016555 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MLLLLTFLALGAADVGAIALESPLKRLVAETLTLLSTHRTLLIGEGNLMIPTPGHTNYQL CIKEVFQGVDTLRNQTAEGDAVEKLFQNLSSIKDYIDGEKKKCEGERLRVKKFLDYLQVF LGVINTEWTMES NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgcttctgcttttgactttcctggctctcggagctgccgacgttggtgccattgcctta gaaagtcccttgaagagactggtggcagagaccttgacactgctctccactcatcggact ctgctgataggcgaagggaacctgatgattcctactccaggacatacaaattaccaacta tgcattaaagaagtctttcagggggtagacacattgaggaatcaaactgcagaaggggat gccgtggaaaaactcttccagaacttgtcttcaataaaagactacatagatggcgaaaaa aaaaagtgtgaaggggaacgattgagagtaaaaaagttcctagactacctgcaagtattt cttggcgtgataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system