Myotis lucifugus (little brown bat): 102431058 Help Entry 102431058         CDS       T07795                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04620   Toll-like receptor signaling pathway mlf04622   RIG-I-like receptor signaling pathway mlf04625   C-type lectin receptor signaling pathway mlf04630   JAK-STAT signaling pathway mlf04658   Th1 and Th2 cell differentiation mlf04936   Alcoholic liver disease mlf04940   Type I diabetes mellitus mlf05133   Pertussis mlf05134   Legionellosis mlf05140   Leishmaniasis mlf05142   Chagas disease mlf05143   African trypanosomiasis mlf05144   Malaria mlf05145   Toxoplasmosis mlf05146   Amoebiasis mlf05152   Tuberculosis mlf05162   Measles mlf05164   Influenza A mlf05168   Herpes simplex virus 1 infection mlf05171   Coronavirus disease - COVID-19 mlf05200   Pathways in cancer mlf05321   Inflammatory bowel disease mlf05330   Allograft rejection mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102431058 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102431058 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102431058 (IL12A)    04622 RIG-I-like receptor signaling pathway     102431058 (IL12A)    04625 C-type lectin receptor signaling pathway     102431058 (IL12A)    04658 Th1 and Th2 cell differentiation     102431058 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102431058 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     102431058 (IL12A)    05164 Influenza A     102431058 (IL12A)    05162 Measles     102431058 (IL12A)    05168 Herpes simplex virus 1 infection     102431058 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     102431058 (IL12A)    05134 Legionellosis     102431058 (IL12A)    05152 Tuberculosis     102431058 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102431058 (IL12A)    05144 Malaria     102431058 (IL12A)    05145 Toxoplasmosis     102431058 (IL12A)    05140 Leishmaniasis     102431058 (IL12A)    05142 Chagas disease     102431058 (IL12A)    05143 African trypanosomiasis     102431058 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     102431058 (IL12A)    05330 Allograft rejection     102431058 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102431058 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102431058 (IL12A)    04936 Alcoholic liver disease     102431058 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102431058 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102431058 (IL12A) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    102431058 (IL12A) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Cytokines    102431058 (IL12A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  102431058 NCBI-ProteinID:  XP_023610943 LinkDB All DBs Position Unknown AA seq 230 aa AA seqDB search MRPPRSEYPAAGTPARVGRAAPGKRRQNLGLLLAVSLVLLHHLSLARNLPTTATAGPGMF ACLSHSRNLLKAVSSTLHKARQTLEFYSCTSEEIDHEDITKDKTSTVEACLPLELITNGS CLASRTASFMTTLCLSSIYEDLKMYQVEFKAINAKLLMDPKRQIILDQNMLAAIDELMQA LNFNSAAVPQKPALEELDLYKTKVKLCILLHAFRVRAVTINRMMSYLNSS NT seq 693 nt NT seq  +upstreamnt  +downstreamnt atgcgccccccgcgcagtgagtacccggcggccgggacaccggctcgggtggggagggcg gcgcccggcaagaggaggcagaaccttggcctcctcctggcagtttctctggtcctcctg caccacctcagtttggccaggaacctccccaccacagccacggcaggccctggcatgttc gcgtgcctcagccactcccggaacctgctgaaggccgtcagcagcacgcttcacaaggcc agacaaacattagaattttactcctgcacttctgaagagattgatcatgaagatatcaca aaagataaaaccagcaccgtagaagcctgcctaccactggaattaatcacgaatgggagt tgcctggcttccagaacggcctcttttatgacgaccctgtgcctcagtagtatctatgag gacttgaagatgtaccaggtggagttcaaggccataaatgcaaagcttttgatggatcct aagaggcagatcattctggatcaaaacatgttggcagctattgatgagctgatgcaggcc ctgaatttcaacagtgcggctgtgccacagaaacccgccctggaagaactggatctttac aagacgaaagtcaagctctgcatcctccttcacgctttcagagtccgcgcagtgactatc aacaggatgatgagctatctgaattcttcctaa

DBGET integrated database retrieval system