Myotis lucifugus (little brown bat): 102431539 Help Entry 102431539         CDS       T07795                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf03008   Ribosome biogenesis in eukaryotes mlf03083   Polycomb repressive complex mlf04064   NF-kappa B signaling pathway mlf04137   Mitophagy - animal mlf04310   Wnt signaling pathway mlf04520   Adherens junction mlf05010   Alzheimer disease mlf05020   Prion disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05162   Measles mlf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mlf00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     102431539 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     102431539 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102431539 (CSNK2B)    04064 NF-kappa B signaling pathway     102431539 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102431539 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     102431539 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102431539 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     102431539 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102431539 (CSNK2B)    05020 Prion disease     102431539 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     102431539 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mlf03009]     102431539 (CSNK2B)    03036 Chromosome and associated proteins [BR:mlf03036]     102431539 (CSNK2B) Ribosome biogenesis [BR:mlf03009]  Eukaryotic type   90S particles    Kinase     102431539 (CSNK2B) Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      102431539 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  102431539 NCBI-ProteinID:  XP_006104681 Ensembl:  ENSMLUG00000009414 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatctcctggttctgtgggctccgtggcaatgag ttcttctgtgaagtggatgaagactacatccaggacaaattcaatctcactgggctcaac gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagtgacctgattgagcaggcagctgagatgctgtat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaaa taccagcagggagactttggctactgtccacgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggggaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcctccaggcaccaccacacggacggcgcgtacttcggc actggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcctgcc aaccagtttgtgcccaggctctatggtttcaagatccatccgatggcctaccagctgcag ctccaagccgcgagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system