Myotis lucifugus (little brown bat): 102431999 Help Entry 102431999         CDS       T07795                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01521   EGFR tyrosine kinase inhibitor resistance mlf01522   Endocrine resistance mlf04010   MAPK signaling pathway mlf04012   ErbB signaling pathway mlf04014   Ras signaling pathway mlf04015   Rap1 signaling pathway mlf04062   Chemokine signaling pathway mlf04068   FoxO signaling pathway mlf04071   Sphingolipid signaling pathway mlf04072   Phospholipase D signaling pathway mlf04137   Mitophagy - animal mlf04140   Autophagy - animal mlf04150   mTOR signaling pathway mlf04151   PI3K-Akt signaling pathway mlf04210   Apoptosis mlf04211   Longevity regulating pathway mlf04213   Longevity regulating pathway - multiple species mlf04218   Cellular senescence mlf04360   Axon guidance mlf04370   VEGF signaling pathway mlf04371   Apelin signaling pathway mlf04540   Gap junction mlf04550   Signaling pathways regulating pluripotency of stem cells mlf04625   C-type lectin receptor signaling pathway mlf04650   Natural killer cell mediated cytotoxicity mlf04660   T cell receptor signaling pathway mlf04662   B cell receptor signaling pathway mlf04664   Fc epsilon RI signaling pathway mlf04714   Thermogenesis mlf04720   Long-term potentiation mlf04722   Neurotrophin signaling pathway mlf04725   Cholinergic synapse mlf04726   Serotonergic synapse mlf04730   Long-term depression mlf04810   Regulation of actin cytoskeleton mlf04910   Insulin signaling pathway mlf04912   GnRH signaling pathway mlf04914   Progesterone-mediated oocyte maturation mlf04915   Estrogen signaling pathway mlf04916   Melanogenesis mlf04917   Prolactin signaling pathway mlf04919   Thyroid hormone signaling pathway mlf04921   Oxytocin signaling pathway mlf04926   Relaxin signaling pathway mlf04929   GnRH secretion mlf04933   AGE-RAGE signaling pathway in diabetic complications mlf04935   Growth hormone synthesis, secretion and action mlf04960   Aldosterone-regulated sodium reabsorption mlf05010   Alzheimer disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05034   Alcoholism mlf05160   Hepatitis C mlf05161   Hepatitis B mlf05163   Human cytomegalovirus infection mlf05165   Human papillomavirus infection mlf05166   Human T-cell leukemia virus 1 infection mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05203   Viral carcinogenesis mlf05205   Proteoglycans in cancer mlf05206   MicroRNAs in cancer mlf05207   Chemical carcinogenesis - receptor activation mlf05208   Chemical carcinogenesis - reactive oxygen species mlf05210   Colorectal cancer mlf05211   Renal cell carcinoma mlf05212   Pancreatic cancer mlf05213   Endometrial cancer mlf05214   Glioma mlf05215   Prostate cancer mlf05216   Thyroid cancer mlf05218   Melanoma mlf05219   Bladder cancer mlf05220   Chronic myeloid leukemia mlf05221   Acute myeloid leukemia mlf05223   Non-small cell lung cancer mlf05224   Breast cancer mlf05225   Hepatocellular carcinoma mlf05226   Gastric cancer mlf05230   Central carbon metabolism in cancer mlf05231   Choline metabolism in cancer mlf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102431999 (KRAS)    04012 ErbB signaling pathway     102431999 (KRAS)    04014 Ras signaling pathway     102431999 (KRAS)    04015 Rap1 signaling pathway     102431999 (KRAS)    04370 VEGF signaling pathway     102431999 (KRAS)    04371 Apelin signaling pathway     102431999 (KRAS)    04068 FoxO signaling pathway     102431999 (KRAS)    04072 Phospholipase D signaling pathway     102431999 (KRAS)    04071 Sphingolipid signaling pathway     102431999 (KRAS)    04151 PI3K-Akt signaling pathway     102431999 (KRAS)    04150 mTOR signaling pathway     102431999 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102431999 (KRAS)    04137 Mitophagy - animal     102431999 (KRAS)   09143 Cell growth and death    04210 Apoptosis     102431999 (KRAS)    04218 Cellular senescence     102431999 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     102431999 (KRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102431999 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102431999 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102431999 (KRAS)    04650 Natural killer cell mediated cytotoxicity     102431999 (KRAS)    04660 T cell receptor signaling pathway     102431999 (KRAS)    04662 B cell receptor signaling pathway     102431999 (KRAS)    04664 Fc epsilon RI signaling pathway     102431999 (KRAS)    04062 Chemokine signaling pathway     102431999 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102431999 (KRAS)    04929 GnRH secretion     102431999 (KRAS)    04912 GnRH signaling pathway     102431999 (KRAS)    04915 Estrogen signaling pathway     102431999 (KRAS)    04914 Progesterone-mediated oocyte maturation     102431999 (KRAS)    04917 Prolactin signaling pathway     102431999 (KRAS)    04921 Oxytocin signaling pathway     102431999 (KRAS)    04926 Relaxin signaling pathway     102431999 (KRAS)    04935 Growth hormone synthesis, secretion and action     102431999 (KRAS)    04919 Thyroid hormone signaling pathway     102431999 (KRAS)    04916 Melanogenesis     102431999 (KRAS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102431999 (KRAS)   09156 Nervous system    04725 Cholinergic synapse     102431999 (KRAS)    04726 Serotonergic synapse     102431999 (KRAS)    04720 Long-term potentiation     102431999 (KRAS)    04730 Long-term depression     102431999 (KRAS)    04722 Neurotrophin signaling pathway     102431999 (KRAS)   09158 Development and regeneration    04360 Axon guidance     102431999 (KRAS)   09149 Aging    04211 Longevity regulating pathway     102431999 (KRAS)    04213 Longevity regulating pathway - multiple species     102431999 (KRAS)   09159 Environmental adaptation    04714 Thermogenesis     102431999 (KRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102431999 (KRAS)    05206 MicroRNAs in cancer     102431999 (KRAS)    05205 Proteoglycans in cancer     102431999 (KRAS)    05207 Chemical carcinogenesis - receptor activation     102431999 (KRAS)    05208 Chemical carcinogenesis - reactive oxygen species     102431999 (KRAS)    05203 Viral carcinogenesis     102431999 (KRAS)    05230 Central carbon metabolism in cancer     102431999 (KRAS)    05231 Choline metabolism in cancer     102431999 (KRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102431999 (KRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102431999 (KRAS)    05212 Pancreatic cancer     102431999 (KRAS)    05225 Hepatocellular carcinoma     102431999 (KRAS)    05226 Gastric cancer     102431999 (KRAS)    05214 Glioma     102431999 (KRAS)    05216 Thyroid cancer     102431999 (KRAS)    05221 Acute myeloid leukemia     102431999 (KRAS)    05220 Chronic myeloid leukemia     102431999 (KRAS)    05218 Melanoma     102431999 (KRAS)    05211 Renal cell carcinoma     102431999 (KRAS)    05219 Bladder cancer     102431999 (KRAS)    05215 Prostate cancer     102431999 (KRAS)    05213 Endometrial cancer     102431999 (KRAS)    05224 Breast cancer     102431999 (KRAS)    05223 Non-small cell lung cancer     102431999 (KRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102431999 (KRAS)    05170 Human immunodeficiency virus 1 infection     102431999 (KRAS)    05161 Hepatitis B     102431999 (KRAS)    05160 Hepatitis C     102431999 (KRAS)    05163 Human cytomegalovirus infection     102431999 (KRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102431999 (KRAS)    05165 Human papillomavirus infection     102431999 (KRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102431999 (KRAS)    05022 Pathways of neurodegeneration - multiple diseases     102431999 (KRAS)   09165 Substance dependence    05034 Alcoholism     102431999 (KRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102431999 (KRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102431999 (KRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102431999 (KRAS)    01522 Endocrine resistance     102431999 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102431999 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mlf04031]     102431999 (KRAS) Membrane trafficking [BR:mlf04131]  Endocytosis   Macropinocytosis    Ras GTPases     102431999 (KRAS) GTP-binding proteins [BR:mlf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102431999 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin DUF6974 Motif Other DBs NCBI-GeneID:  102431999 NCBI-ProteinID:  XP_014312991 Ensembl:  ENSMLUG00000015948 UniProt:  G1PTH5 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIIM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg atacagctaattcagaatcactttgtggatgaatatgatcctacaatagaggattcctac aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt gtgaaaattaaaaaatgcattataatgtaa

DBGET integrated database retrieval system