Myotis lucifugus (little brown bat): 102433200 Help Entry 102433200         CDS       T07795                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04061   Viral protein interaction with cytokine and cytokine receptor mlf04151   PI3K-Akt signaling pathway mlf04625   C-type lectin receptor signaling pathway mlf04630   JAK-STAT signaling pathway mlf04658   Th1 and Th2 cell differentiation mlf04659   Th17 cell differentiation mlf04660   T cell receptor signaling pathway mlf04672   Intestinal immune network for IgA production mlf04940   Type I diabetes mellitus mlf05135   Yersinia infection mlf05142   Chagas disease mlf05162   Measles mlf05166   Human T-cell leukemia virus 1 infection mlf05171   Coronavirus disease - COVID-19 mlf05200   Pathways in cancer mlf05320   Autoimmune thyroid disease mlf05321   Inflammatory bowel disease mlf05330   Allograft rejection mlf05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102433200 (IL2)    04151 PI3K-Akt signaling pathway     102433200 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102433200 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     102433200 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102433200 (IL2)    04660 T cell receptor signaling pathway     102433200 (IL2)    04658 Th1 and Th2 cell differentiation     102433200 (IL2)    04659 Th17 cell differentiation     102433200 (IL2)    04672 Intestinal immune network for IgA production     102433200 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102433200 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102433200 (IL2)    05171 Coronavirus disease - COVID-19     102433200 (IL2)    05162 Measles     102433200 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     102433200 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     102433200 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     102433200 (IL2)    05321 Inflammatory bowel disease     102433200 (IL2)    05330 Allograft rejection     102433200 (IL2)    05332 Graft-versus-host disease     102433200 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102433200 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102433200 (IL2)    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102433200 (IL2) Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    102433200 (IL2) Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Cytokines    102433200 (IL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL2 CDK5RAP3 Surfac_D-trimer Motif Other DBs NCBI-GeneID:  102433200 NCBI-ProteinID:  XP_006081721 Ensembl:  ENSMLUG00000011800 UniProt:  G1PJ32 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MYKMHFLSCIALTLAFIADGAPTSSSSQETQQQLEHLILDMQRLLNGVSNYKNSKLPMML TFKFYMPRNATELKHLQCLVDELKPLEEVLKLEKSLSNITELMSNVNVLVQNLKGPKTRF ECDYDDETVTIVEFLNKWITFCQRIFSTLT NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatgcacttcttgtcctgtattgcactaactctcgcattcatcgcagacggt gcacctacctcgagctccagccaggaaacacagcagcagctggagcacctgatactggat atgcagcggcttctgaatggagtcagcaattacaagaactccaagctccccatgatgctc acgtttaagttttacatgcccaggaatgccacagaattgaaacatctgcagtgtctagta gacgaacttaaacctctggaggaagtgctaaagttagagaaaagcttgagcaatattacg gaattaatgagcaatgtcaatgtactcgttcagaacctgaagggacctaaaacgagattc gaatgtgactatgatgatgagacggtgaccatcgtagaattcctgaacaagtggattacc ttttgtcaaagaatcttctcaacactgacttaa

DBGET integrated database retrieval system