Myotis lucifugus (little brown bat): 102435889 Help Entry 102435889         CDS       T07795                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04145   Phagocytosis mlf04814   Motor proteins mlf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlf00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     102435889 (DYNLT3)   09142 Cell motility    04814 Motor proteins     102435889 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102435889 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mlf03037]     102435889 (DYNLT3)    04812 Cytoskeleton proteins [BR:mlf04812]     102435889 (DYNLT3) Cilium and associated proteins [BR:mlf03037]  Motile cilia and associated proteins   Dynein arm    102435889 (DYNLT3) Cytoskeleton proteins [BR:mlf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102435889 (DYNLT3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 DUF3781 Motif Other DBs NCBI-GeneID:  102435889 NCBI-ProteinID:  XP_006083016 Ensembl:  ENSMLUG00000015093 UniProt:  G1PRI0 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MEEYHRHCEEVGFNVDEAHNLVKECIDGVLGGEDYNQNNINQWTASIVEQSLAHLVKLGK AYKYIVTCAVVQRSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaggagtaccatcgccactgcgaggaggttggtttcaatgtggatgaagcccacaac cttgttaaagagtgtatagatggagttttgggtggtgaagattataatcagaacaacatc aaccaatggactgcaagtattgtggaacaatccttagcacatttggttaagttgggaaaa gcttataaatatattgtgacctgtgcagtggtccagaggagtgcatatggctttcacaca gccagctcatgcttttgggataccacatctgatggaacctgtactgtgagatgggagaac cgaaccatgaactgtattgtcaatgtttttgccattgctattgtcctgtga

DBGET integrated database retrieval system