Myotis lucifugus (little brown bat): 102436650 Help Entry 102436650         CDS       T07795                                  Symbol CFL2 Name (RefSeq) cofilin-2 isoform X2   KO K05765   cofilin Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04360   Axon guidance mlf04666   Fc gamma R-mediated phagocytosis mlf04810   Regulation of actin cytoskeleton mlf05133   Pertussis mlf05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:mlf00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102436650 (CFL2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     102436650 (CFL2)   09158 Development and regeneration    04360 Axon guidance     102436650 (CFL2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102436650 (CFL2)   09171 Infectious disease: bacterial    05133 Pertussis     102436650 (CFL2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102436650 (CFL2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mlf04812]     102436650 (CFL2)    04147 Exosome [BR:mlf04147]     102436650 (CFL2) Membrane trafficking [BR:mlf04131]  Others   Actin-binding proteins    Others     102436650 (CFL2) Cytoskeleton proteins [BR:mlf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      102436650 (CFL2) Exosome [BR:mlf04147]  Exosomal proteins   Proteins found in most exosomes    102436650 (CFL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  102436650 NCBI-ProteinID:  XP_006107662 Ensembl:  ENSMLUG00000007057 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPL NDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQV NGLDDIKDRSTLGEKLGGNVVVSLEGKPL NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgaaagtaaggaaatcgtctacacaagaagagatcaaaaaaagaaagaaagcagttctc ttctgtttaagcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtg ggtgacattggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctg aatgattgccgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaa gacctagtatttatattctgggctcctgaaagtgcacctttaaaaagcaagatgatttat gctagctctaaagatgccattaagaagaaatttacaggtattaaacatgagtggcaagta aatggcttggatgacataaaggaccgttcaacacttggagagaaattgggaggcaacgta gtagtttcacttgaaggaaaacccttataa

DBGET integrated database retrieval system