Myotis lucifugus (little brown bat): 102437221 Help Entry 102437221         CDS       T07795                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04140   Autophagy - animal mlf04144   Endocytosis mlf04152   AMPK signaling pathway mlf04530   Tight junction mlf04972   Pancreatic secretion mlf05014   Amyotrophic lateral sclerosis mlf05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     102437221 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102437221 (RAB8A)    04140 Autophagy - animal     102437221 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     102437221 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     102437221 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102437221 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     102437221 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlf04131]     102437221 (RAB8A)    03036 Chromosome and associated proteins [BR:mlf03036]     102437221 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102437221 (RAB8A)    04031 GTP-binding proteins [BR:mlf04031]     102437221 (RAB8A) Membrane trafficking [BR:mlf04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102437221 (RAB8A)  Autophagy   Other autophagy associated proteins     102437221 (RAB8A) Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102437221 (RAB8A) Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102437221 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    102437221 (RAB8A)   Exosomal proteins of colorectal cancer cells    102437221 (RAB8A) GTP-binding proteins [BR:mlf04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102437221 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  102437221 NCBI-ProteinID:  XP_006099711 Ensembl:  ENSMLUG00000006982 UniProt:  G1P889 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKKTSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaaactacag atatgggacacagctggccaggaacggtttcggacgatcacgacagcttactacaggggc gcaatgggcatcatgctggtctacgacatcaccaacgagaagtcctttgacaacatccgg aactggattcggaacattgaggagcatgcctctgcagatgttgaaaagatgatacttgga aacaagtgtgacgtgaacgacaagagacaagtctccaaggaacggggagagaagctggcc ctggactatggaatcaagttcatggagaccagtgcaaaggccaacatcaatgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaaaaagaccagc ttttttcgatgtgttcttctgtga

DBGET integrated database retrieval system