Myotis lucifugus (little brown bat): 102437551 Help Entry 102437551         CDS       T07795                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04613   Neutrophil extracellular trap formation mlf05034   Alcoholism mlf05202   Transcriptional misregulation in cancer mlf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102437551  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102437551   09163 Immune disease    05322 Systemic lupus erythematosus     102437551   09165 Substance dependence    05034 Alcoholism     102437551  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlf03036]     102437551   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     102437551 Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102437551 Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102437551 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102437551 NCBI-ProteinID:  XP_023605537 Ensembl:  ENSMLUG00000030319 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSAGGKAPRKQLATKAARKSSPSTGGVKKPHRYRPGTVSLREIRRYQKSTE LLIRKLPFQRLVREIAQDFRTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIPGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgcaaatccgcaggtgggaaagcgccccgcaaacag ctggccacgaaagctgccaggaaaagcagcccctctaccggcggggtgaagaagccccat cgctacaggcccgggaccgtctcgcttcgagaaatccgccgttaccagaaatccaccgag cttctgatccgcaagctgcctttccagaggttggtgagggagattgcccaggatttcaga accgacctgaggttccagagcgcagccatcggtgcgctgcaggaggctagcgaggcatac ctggtgggtctatttgaagatactaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagctggctcgccggattccgggagagagagcctaa

DBGET integrated database retrieval system