Myotis lucifugus (little brown bat): 102437642 Help Entry 102437642         CDS       T07795                                  Name (RefSeq) C-C motif chemokine 18-like   KO K05408   C-C motif chemokine 3 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04061   Viral protein interaction with cytokine and cytokine receptor mlf04062   Chemokine signaling pathway mlf04620   Toll-like receptor signaling pathway mlf05142   Chagas disease mlf05163   Human cytomegalovirus infection mlf05323   Rheumatoid arthritis mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102437642    04061 Viral protein interaction with cytokine and cytokine receptor     102437642  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102437642    04062 Chemokine signaling pathway     102437642  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102437642   09174 Infectious disease: parasitic    05142 Chagas disease     102437642   09163 Immune disease    05323 Rheumatoid arthritis     102437642   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102437642  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     102437642    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     102437642 Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Chemokines    102437642 Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Chemokines    102437642 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF7077 Motif Other DBs NCBI-GeneID:  102437642 NCBI-ProteinID:  XP_006101971 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MKFLGATVLVILCTRVLYSYEEESTDISVTCCMTYVTRQIPRKFVVAYFETSTKCPQYGV VFLTKRGRNICANPSDAWVQKYINNLKETPQAVQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagttccttggagctaccgtccttgtcatcctctgcaccagggtcctctactcctac gaggaagaaagcactgacatctcagtcacctgctgcatgacctacgtgacccggcagatc ccccgcaaatttgtggttgcctactttgagaccagcaccaagtgcccccaatatggtgtt gtctttctcaccaaaaggggccggaatatctgtgccaatcccagcgatgcctgggttcag aaatacatcaacaacctgaaggagactccccaagcagtccagtag

DBGET integrated database retrieval system