Myotis lucifugus (little brown bat): 102441557 Help Entry 102441557         CDS       T07795                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04072   Phospholipase D signaling pathway mlf04140   Autophagy - animal mlf04150   mTOR signaling pathway mlf04151   PI3K-Akt signaling pathway mlf04152   AMPK signaling pathway mlf04211   Longevity regulating pathway mlf04218   Cellular senescence mlf04714   Thermogenesis mlf04910   Insulin signaling pathway mlf04919   Thyroid hormone signaling pathway mlf05163   Human cytomegalovirus infection mlf05165   Human papillomavirus infection mlf05168   Herpes simplex virus 1 infection mlf05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     102441557 (RHEB)    04151 PI3K-Akt signaling pathway     102441557 (RHEB)    04152 AMPK signaling pathway     102441557 (RHEB)    04150 mTOR signaling pathway     102441557 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102441557 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     102441557 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102441557 (RHEB)    04919 Thyroid hormone signaling pathway     102441557 (RHEB)   09149 Aging    04211 Longevity regulating pathway     102441557 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     102441557 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     102441557 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     102441557 (RHEB)    05163 Human cytomegalovirus infection     102441557 (RHEB)    05165 Human papillomavirus infection     102441557 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mlf04031]     102441557 (RHEB) GTP-binding proteins [BR:mlf04031]  Small (monomeric) G-proteins   Ras Family    Rheb     102441557 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase UPA-FIIND RhoGAP_pG1_pG2 Motif Other DBs NCBI-GeneID:  102441557 NCBI-ProteinID:  XP_023620320 LinkDB All DBs Position Unknown AA seq 226 aa AA seqDB search MVQIQVLFILVHDLYELLNKTYGEIQPWLNIQKERIRNDLGKLETCPGVSGSGTHYGLSG KSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDI NGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNKKDLHMERVISYEEGKALA ESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSSCSVM NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atggttcaaatacaggttctctttattcttgttcatgacttgtatgagttactgaataaa acatacggcgaaattcaaccatggctgaacatccagaaggagaggattcggaatgacctt ggcaaactggagacatgccctggcgtgagcggaagtggaacacactatggactttctggg aaatcctcgttgacgattcagtttgttgaaggccaatttgttgactcctatgacccaacc atagagaacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcaactt gtagacacagctgggcaagatgaatattccatctttccccagacgtactccatagatatt aatggttatattctcgtgtattctgtgacatcgatcaaaagttttgaggtgattaaagtt atccatggcaagttgttggacatggtggggaaagtgcaaatacctattatgttggttggg aataagaaagacctacatatggaaagggtgatcagttatgaagaagggaaggcgttagca gaatcttggaatgcagcttttttggaatcttctgctaaagagaatcaaactgctgttgat gtgttcagaaggataattttggaggcagaaaaaattgatggggctgcttcacaaggaaag tcttcctgctcggtgatgtaa

DBGET integrated database retrieval system