Myotis lucifugus (little brown bat): 102443091 Help Entry 102443091         CDS       T07795                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf01521   EGFR tyrosine kinase inhibitor resistance mlf01524   Platinum drug resistance mlf04014   Ras signaling pathway mlf04064   NF-kappa B signaling pathway mlf04115   p53 signaling pathway mlf04137   Mitophagy - animal mlf04140   Autophagy - animal mlf04151   PI3K-Akt signaling pathway mlf04210   Apoptosis mlf04215   Apoptosis - multiple species mlf04621   NOD-like receptor signaling pathway mlf04630   JAK-STAT signaling pathway mlf05012   Parkinson disease mlf05014   Amyotrophic lateral sclerosis mlf05022   Pathways of neurodegeneration - multiple diseases mlf05145   Toxoplasmosis mlf05162   Measles mlf05166   Human T-cell leukemia virus 1 infection mlf05168   Herpes simplex virus 1 infection mlf05170   Human immunodeficiency virus 1 infection mlf05200   Pathways in cancer mlf05202   Transcriptional misregulation in cancer mlf05212   Pancreatic cancer mlf05220   Chronic myeloid leukemia mlf05222   Small cell lung cancer mlf05225   Hepatocellular carcinoma mlf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102443091 (BCL2L1)    04630 JAK-STAT signaling pathway     102443091 (BCL2L1)    04064 NF-kappa B signaling pathway     102443091 (BCL2L1)    04151 PI3K-Akt signaling pathway     102443091 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102443091 (BCL2L1)    04137 Mitophagy - animal     102443091 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     102443091 (BCL2L1)    04215 Apoptosis - multiple species     102443091 (BCL2L1)    04115 p53 signaling pathway     102443091 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102443091 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102443091 (BCL2L1)    05202 Transcriptional misregulation in cancer     102443091 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     102443091 (BCL2L1)    05225 Hepatocellular carcinoma     102443091 (BCL2L1)    05220 Chronic myeloid leukemia     102443091 (BCL2L1)    05222 Small cell lung cancer     102443091 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102443091 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     102443091 (BCL2L1)    05162 Measles     102443091 (BCL2L1)    05168 Herpes simplex virus 1 infection     102443091 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102443091 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     102443091 (BCL2L1)    05014 Amyotrophic lateral sclerosis     102443091 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     102443091 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102443091 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102443091 (BCL2L1)    01524 Platinum drug resistance     102443091 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlf01009]     102443091 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlf03036]     102443091 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mlf02000]     102443091 (BCL2L1) Protein phosphatases and associated proteins [BR:mlf01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102443091 (BCL2L1) Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102443091 (BCL2L1) Transporters [BR:mlf02000]  Other transporters   Pores ion channels [TC:1]    102443091 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102443091 NCBI-ProteinID:  XP_006089454 Ensembl:  ENSMLUG00000007491 UniProt:  G1P9D2 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEVETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagaggtggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccctgcggtgaatggagccactggccacagcagtagcttggatgcccgggaggtg attcccatggcagcggtgaagcaagcgctgagggaggcaggcgacgagtttgaactgagg taccggcgggcgttcagcgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgagcaagtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctcgttcggtggggcattgtgcgtggaaagtgtggacaaggagatgcag gtattggtgagtcggattgcaacgtggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggaggctgggacacttttgtggaactctacgggaacaacgcagca gccgagagccggaagggccaggaacgcttcaatcgctggttcctgacgggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system