Myotis lucifugus (little brown bat): 106698680 Help Entry 106698680         CDS       T07795                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf03010   Ribosome mlf04120   Ubiquitin mediated proteolysis mlf04137   Mitophagy - animal mlf04140   Autophagy - animal mlf05012   Parkinson disease mlf05022   Pathways of neurodegeneration - multiple diseases mlf05167   Kaposi sarcoma-associated herpesvirus infection mlf05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:mlf00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     106698680   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     106698680  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106698680    04137 Mitophagy - animal     106698680  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     106698680    05167 Kaposi sarcoma-associated herpesvirus infection     106698680   09164 Neurodegenerative disease    05012 Parkinson disease     106698680    05022 Pathways of neurodegeneration - multiple diseases     106698680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mlf03011]     106698680    04121 Ubiquitin system [BR:mlf04121]     106698680 Ribosome [BR:mlf03011]  Ribosomal proteins   Eukaryotes    Large subunit     106698680   Archaea     106698680 Ubiquitin system [BR:mlf04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    106698680 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Motif Other DBs NCBI-GeneID:  106698680 NCBI-ProteinID:  XP_014319090 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MYDTRIGGAASPADTEWQLFVKTLTGKIIALEVEPSDPTDHAKAKLQDREGLPPDQQCLV FVGKQLEDGRTFRLQYSERIRPWHLALPLRRHREPSLRQFAQKYDCDKMICAGVPPTWAP VLSTATKRSHTNNLCF NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atgtatgacacccgtataggaggagcagcatccccagcagacacagaatggcagctcttt gtgaagaccctgactggcaagatcatcgccctggaggtggagcccagtgaccccactgac catgccaaagctaaactccaagacagggagggcctcccgcctgaccagcagtgtctggtt tttgtgggcaagcagctggaggatggacgcacattcagactacaatattcagaaagaatt cgcccttggcacttggcacttcctctgcggaggcatcgtgagccctccctccgccagttc gcccagaagtacgactgcgacaagatgatctgtgcaggtgtcccgcccacctgggcccct gtgctgtcaactgccacaaagcgcagccacaccaacaatctgtgcttctag

DBGET integrated database retrieval system