Myotis lucifugus (little brown bat): 106699073 Help Entry 106699073         CDS       T07795                                  Name (RefSeq) interleukin-3-like   KO K04736   interleukin 3 Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04060   Cytokine-cytokine receptor interaction mlf04151   PI3K-Akt signaling pathway mlf04210   Apoptosis mlf04630   JAK-STAT signaling pathway mlf04640   Hematopoietic cell lineage mlf04664   Fc epsilon RI signaling pathway mlf05200   Pathways in cancer mlf05202   Transcriptional misregulation in cancer mlf05221   Acute myeloid leukemia mlf05310   Asthma Brite KEGG Orthology (KO) [BR:mlf00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     106699073    04151 PI3K-Akt signaling pathway     106699073   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     106699073  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     106699073  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     106699073    04664 Fc epsilon RI signaling pathway     106699073  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     106699073    05202 Transcriptional misregulation in cancer     106699073   09162 Cancer: specific types    05221 Acute myeloid leukemia     106699073   09163 Immune disease    05310 Asthma     106699073  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlf04052]     106699073    00536 Glycosaminoglycan binding proteins [BR:mlf00536]     106699073 Cytokines and neuropeptides [BR:mlf04052]  Cytokines   Interleukins    106699073 Glycosaminoglycan binding proteins [BR:mlf00536]  Heparan sulfate / Heparin   Cytokines    106699073 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL3 Motif Other DBs NCBI-GeneID:  106699073 NCBI-ProteinID:  XP_014321052 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MRPASPKMSSLPVLPLFLLLLALHAPRAQGRPLTTCRELLSEIENILKKPPVPSEEPLSL NEQFILKVFKTVLPTSTSKENLFSIKNWGDFRTKLREYLGTLKNYRSPPGSSQGTH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcggcctgccagcccaaagatgagcagcctccccgtcctgccccttttcctgctcctg ctcgcactccacgctcctcgggcacaggggcggcccttaacgacttgccgggaactgctc agcgaaatcgagaacatcctgaaaaagccgcctgtgccttcagaagaacccttgagctta aatgaacaattcatcctgaaggtattcaagacagtcctgcccacctccacgtccaaggaa aacctgttcagtatcaagaactggggagatttcaggacgaaactgagagaatatctgggc acccttaaaaactaccgatcccctccaggctccagccaagggacgcactga

DBGET integrated database retrieval system