Myotis lucifugus (little brown bat): 106699200 Help Entry 106699200         CDS       T07795                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism mlf  Myotis lucifugus (little brown bat) Pathway mlf04613   Neutrophil extracellular trap formation mlf05034   Alcoholism mlf05203   Viral carcinogenesis mlf05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlf00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106699200  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106699200   09163 Immune disease    05322 Systemic lupus erythematosus     106699200   09165 Substance dependence    05034 Alcoholism     106699200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlf03036]     106699200   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlf04147]     106699200 Chromosome and associated proteins [BR:mlf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106699200 Exosome [BR:mlf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106699200 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  106699200 NCBI-ProteinID:  XP_014321871 LinkDB All DBs Position Unknown AA seq 84 aa AA seqDB search MGDHLTDLHRLASPELAMSIMNSLVNDMFERLACEATRLAQYSGRTTLTSREVQTAVCLL LPGELAKHAVSEGTKAVTKYTSSK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgggcgaccacctgactgacctccacaggctggccagccccgagctggctatgagcatc atgaactcacttgtgaatgacatgtttgagcggctggcctgcgaggccacccgactggct cagtactcaggccgaaccacactgacgtcccgggaagttcagacagcagtgtgcctgctg ctgcctggagagctggccaagcacgctgtgtccgagggcaccaaggctgtcaccaagtat accagctccaagtga

DBGET integrated database retrieval system