Mycobacterium liflandii: MULP_03742 Help Entry MULP_03742        CDS       T02444                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mli  Mycobacterium liflandii Pathway mli01100   Metabolic pathways mli01110   Biosynthesis of secondary metabolites Module mli_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mli_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mli00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MULP_03742    00074 Mycolic acid biosynthesis     MULP_03742   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MULP_03742 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGC63381 UniProt:  L7V6H8 LinkDB All DBs Position 4054736..4054993 Genome browser AA seq 85 aa AA seqDB search MTTQQDTRAVVLSVLTTIAPEVDADDICDDVLLRDQVDLDSMDWLNFLLGIHKRMHVDIP ESDYATLRTLNDVVTYVETHASKTA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgacgacacaacaagacacccgcgccgtggtcctgtcggtattgacgaccatcgcgccc gaggtcgacgccgatgacatctgtgacgatgtgctgctgcgcgatcaggtcgatcttgac tcgatggattggctgaactttctactcggtatccacaaacggatgcacgtggacatcccc gaatccgactacgcgaccctgcgcaccctcaacgatgtcgtgacctacgtcgagacacac gcgtccaaaaccgcttga

DBGET integrated database retrieval system