Maribacter litopenaei: NYZ99_09930 Help Entry NYZ99_09930       CDS       T08914                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mlio  Maribacter litopenaei Pathway mlio01100   Metabolic pathways mlio01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mlio00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NYZ99_09930    00074 Mycolic acid biosynthesis     NYZ99_09930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NYZ99_09930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SNF2_assoc Motif Other DBs NCBI-ProteinID:  UWX56468 UniProt:  A0ABY5YBP2 LinkDB All DBs Position 1854586..1854771 Genome browser AA seq 61 aa AA seqDB search MQETEKYQKLKDIIQIYLPEDVSVNDIQPSSNFVTELNINSANLVDIILDVEDTFDIRLG K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgcaagaaacggaaaaataccaaaaattaaaggacatcattcaaatctatctaccggag gatgtttccgtaaacgatattcaaccttccagtaattttgtcaccgagttgaacatcaat tcggccaatctagtggacattattttggatgtagaggatacttttgatatccgtctcgga aaatga

DBGET integrated database retrieval system