Massilia litorea: LPB04_15285 Help Entry LPB04_15285       CDS       T09729                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mlir  Massilia litorea Pathway mlir01100   Metabolic pathways mlir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mlir00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LPB04_15285    00074 Mycolic acid biosynthesis     LPB04_15285   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LPB04_15285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  QOL52059 UniProt:  A0A7L9UC95 LinkDB All DBs Position 3398251..3398505 Genome browser AA seq 84 aa AA seqDB search MNRDELFVWIADLLAEMFELDRDALTPESNLYTDLDIDSIDAVDLAVKLKQTTGKRLQPE VFKTIRTIDDVVNALAGLAEEQAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcgacgaactgttcgtctggatcgccgacctgctggccgagatgttcgaactc gaccgcgacgcgctcacgccggagtcgaacctgtacacggacctcgacatcgacagcatc gacgccgtcgacctggccgtgaagctcaagcagaccaccggcaagcgcctgcagccggaa gtgttcaagaccatccgcacgatcgacgacgtcgtgaacgcactggccggcctggcggaa gagcaggcggcctga

DBGET integrated database retrieval system