Mycobacterium lacus: MLAC_05200 Help Entry MLAC_05200        CDS       T07377                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mlj  Mycobacterium lacus Brite KEGG Orthology (KO) [BR:mlj00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MLAC_05200 Enzymes [BR:mlj01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      MLAC_05200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Thioredoxin_2 Ub-Mut7C SH3BGR Glrx-like Thioredoxin GST_N Motif Other DBs NCBI-ProteinID:  BBX95226 UniProt:  A0A1X1YTP3 LinkDB All DBs Position complement(523318..523572) Genome browser AA seq 84 aa AA seqDB search MTNAPLTVYTTSWCGYCFRLKTALEANGIPYDEVDIEQDGAAAEFVGSVNGGNRTVPTVK FADGSTLTNPSAGEVKAKLAGICG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccaatgctccgctcaccgtttacacgacgtcatggtgtggctattgctttcggctc aagacggcgctcgaggccaacggaatcccttacgacgaggtcgatatcgaacaagacggc gcggcagcggaattcgtcggctcggtcaacggcggcaacaggacggtcccgacggtgaag ttcgccgacgggtcgacgctgaccaacccgagcgcaggcgaggtcaaagcgaagctggca ggcatctgcggctaa

DBGET integrated database retrieval system