Mustela lutreola (European mink): 131807889 Help Entry 131807889         CDS       T09578                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism mlk  Mustela lutreola (European mink) Pathway mlk01521   EGFR tyrosine kinase inhibitor resistance mlk01524   Platinum drug resistance mlk04014   Ras signaling pathway mlk04064   NF-kappa B signaling pathway mlk04115   p53 signaling pathway mlk04137   Mitophagy - animal mlk04140   Autophagy - animal mlk04151   PI3K-Akt signaling pathway mlk04210   Apoptosis mlk04215   Apoptosis - multiple species mlk04621   NOD-like receptor signaling pathway mlk04630   JAK-STAT signaling pathway mlk05012   Parkinson disease mlk05014   Amyotrophic lateral sclerosis mlk05022   Pathways of neurodegeneration - multiple diseases mlk05145   Toxoplasmosis mlk05162   Measles mlk05166   Human T-cell leukemia virus 1 infection mlk05168   Herpes simplex virus 1 infection mlk05170   Human immunodeficiency virus 1 infection mlk05200   Pathways in cancer mlk05202   Transcriptional misregulation in cancer mlk05212   Pancreatic cancer mlk05220   Chronic myeloid leukemia mlk05222   Small cell lung cancer mlk05225   Hepatocellular carcinoma mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     131807889 (BCL2L1)    04630 JAK-STAT signaling pathway     131807889 (BCL2L1)    04064 NF-kappa B signaling pathway     131807889 (BCL2L1)    04151 PI3K-Akt signaling pathway     131807889 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131807889 (BCL2L1)    04137 Mitophagy - animal     131807889 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     131807889 (BCL2L1)    04215 Apoptosis - multiple species     131807889 (BCL2L1)    04115 p53 signaling pathway     131807889 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     131807889 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131807889 (BCL2L1)    05202 Transcriptional misregulation in cancer     131807889 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     131807889 (BCL2L1)    05225 Hepatocellular carcinoma     131807889 (BCL2L1)    05220 Chronic myeloid leukemia     131807889 (BCL2L1)    05222 Small cell lung cancer     131807889 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     131807889 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     131807889 (BCL2L1)    05162 Measles     131807889 (BCL2L1)    05168 Herpes simplex virus 1 infection     131807889 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     131807889 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     131807889 (BCL2L1)    05014 Amyotrophic lateral sclerosis     131807889 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     131807889 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131807889 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     131807889 (BCL2L1)    01524 Platinum drug resistance     131807889 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlk01009]     131807889 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlk03036]     131807889 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mlk02000]     131807889 (BCL2L1) Protein phosphatases and associated proteins [BR:mlk01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      131807889 (BCL2L1) Chromosome and associated proteins [BR:mlk03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     131807889 (BCL2L1) Transporters [BR:mlk02000]  Other transporters   Pores ion channels [TC:1]    131807889 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Nitrate_red_del Motif Other DBs NCBI-GeneID:  131807889 NCBI-ProteinID:  XP_058989600 LinkDB All DBs Position 9:26358761..26409104 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDAEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQALVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgcagaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtaaagcaagcgctgagggaggctggggatgagtttgaactgagg taccggcgggcattcagcgacctgacatctcagcttcacatcaccccagggacagcgtat cagagctttgagcaggtggtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggctctgtgtgtggagagcgtagacaaggagatgcag gcattggtgagtcggatcgcaacttggatggccacttacctgaacgaccacctagagcct tggatccaggagaacggcggctgggacactttcgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system