Mustela lutreola (European mink): 131809019 Help Entry 131809019         CDS       T09578                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism mlk  Mustela lutreola (European mink) Pathway mlk01522   Endocrine resistance mlk04010   MAPK signaling pathway mlk04012   ErbB signaling pathway mlk04024   cAMP signaling pathway mlk04137   Mitophagy - animal mlk04210   Apoptosis mlk04310   Wnt signaling pathway mlk04380   Osteoclast differentiation mlk04510   Focal adhesion mlk04530   Tight junction mlk04620   Toll-like receptor signaling pathway mlk04621   NOD-like receptor signaling pathway mlk04625   C-type lectin receptor signaling pathway mlk04657   IL-17 signaling pathway mlk04658   Th1 and Th2 cell differentiation mlk04659   Th17 cell differentiation mlk04660   T cell receptor signaling pathway mlk04662   B cell receptor signaling pathway mlk04668   TNF signaling pathway mlk04722   Neurotrophin signaling pathway mlk04912   GnRH signaling pathway mlk04915   Estrogen signaling pathway mlk04921   Oxytocin signaling pathway mlk04926   Relaxin signaling pathway mlk04932   Non-alcoholic fatty liver disease mlk04933   AGE-RAGE signaling pathway in diabetic complications mlk05030   Cocaine addiction mlk05031   Amphetamine addiction mlk05132   Salmonella infection mlk05133   Pertussis mlk05135   Yersinia infection mlk05140   Leishmaniasis mlk05142   Chagas disease mlk05161   Hepatitis B mlk05162   Measles mlk05166   Human T-cell leukemia virus 1 infection mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05169   Epstein-Barr virus infection mlk05170   Human immunodeficiency virus 1 infection mlk05171   Coronavirus disease - COVID-19 mlk05200   Pathways in cancer mlk05203   Viral carcinogenesis mlk05207   Chemical carcinogenesis - receptor activation mlk05208   Chemical carcinogenesis - reactive oxygen species mlk05210   Colorectal cancer mlk05211   Renal cell carcinoma mlk05224   Breast cancer mlk05231   Choline metabolism in cancer mlk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlk05321   Inflammatory bowel disease mlk05323   Rheumatoid arthritis mlk05417   Lipid and atherosclerosis mlk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131809019 (JUN)    04012 ErbB signaling pathway     131809019 (JUN)    04310 Wnt signaling pathway     131809019 (JUN)    04668 TNF signaling pathway     131809019 (JUN)    04024 cAMP signaling pathway     131809019 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     131809019 (JUN)   09143 Cell growth and death    04210 Apoptosis     131809019 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     131809019 (JUN)    04530 Tight junction     131809019 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131809019 (JUN)    04621 NOD-like receptor signaling pathway     131809019 (JUN)    04625 C-type lectin receptor signaling pathway     131809019 (JUN)    04660 T cell receptor signaling pathway     131809019 (JUN)    04658 Th1 and Th2 cell differentiation     131809019 (JUN)    04659 Th17 cell differentiation     131809019 (JUN)    04657 IL-17 signaling pathway     131809019 (JUN)    04662 B cell receptor signaling pathway     131809019 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     131809019 (JUN)    04915 Estrogen signaling pathway     131809019 (JUN)    04921 Oxytocin signaling pathway     131809019 (JUN)    04926 Relaxin signaling pathway     131809019 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     131809019 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     131809019 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131809019 (JUN)    05207 Chemical carcinogenesis - receptor activation     131809019 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     131809019 (JUN)    05203 Viral carcinogenesis     131809019 (JUN)    05231 Choline metabolism in cancer     131809019 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     131809019 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     131809019 (JUN)    05211 Renal cell carcinoma     131809019 (JUN)    05224 Breast cancer     131809019 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     131809019 (JUN)    05170 Human immunodeficiency virus 1 infection     131809019 (JUN)    05161 Hepatitis B     131809019 (JUN)    05171 Coronavirus disease - COVID-19     131809019 (JUN)    05162 Measles     131809019 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     131809019 (JUN)    05169 Epstein-Barr virus infection     131809019 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     131809019 (JUN)    05135 Yersinia infection     131809019 (JUN)    05133 Pertussis     131809019 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     131809019 (JUN)    05142 Chagas disease     131809019 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     131809019 (JUN)    05321 Inflammatory bowel disease     131809019 (JUN)   09165 Substance dependence    05030 Cocaine addiction     131809019 (JUN)    05031 Amphetamine addiction     131809019 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131809019 (JUN)    05418 Fluid shear stress and atherosclerosis     131809019 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     131809019 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     131809019 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     131809019 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mlk03000]     131809019 (JUN) Transcription factors [BR:mlk03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     131809019 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_Maf bZIP_2 Rab11-FIP3 RIMB1_N MIC19_MIC25 ZapB CCDC192 PspA_IM30 Fib_alpha T4SS_LegC2C7 DUF3450 FlaC_arch TFIIA Map3k7cl Motif Other DBs NCBI-GeneID:  131809019 NCBI-ProteinID:  XP_058991454 LinkDB All DBs Position 10:complement(47377715..47380406) Genome browser AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSGGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQLPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctgaatgcctcgttcctccag tctgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagtatgaccctg aatctggccgacccggtgggtagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctggcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcttgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcagcgcagccggtcagcggggcg ggcatggtggctccggcggtggcttcggcggcgggtggcagcggcagcggcggcttcagt gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg ctgagcggcggcggcggggcgccctcctacggcgctgccggcctggcctttcccgcgcag ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagctccccgtg cagcacccgcggctgcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccctgtcccccatcgacatggagtcgcaggagaggatcaaggcagagagg aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system