Mustela lutreola (European mink): 131810307 Help Entry 131810307         CDS       T09578                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism mlk  Mustela lutreola (European mink) Pathway mlk01521   EGFR tyrosine kinase inhibitor resistance mlk01522   Endocrine resistance mlk04010   MAPK signaling pathway mlk04012   ErbB signaling pathway mlk04014   Ras signaling pathway mlk04015   Rap1 signaling pathway mlk04062   Chemokine signaling pathway mlk04068   FoxO signaling pathway mlk04071   Sphingolipid signaling pathway mlk04072   Phospholipase D signaling pathway mlk04137   Mitophagy - animal mlk04140   Autophagy - animal mlk04150   mTOR signaling pathway mlk04151   PI3K-Akt signaling pathway mlk04210   Apoptosis mlk04211   Longevity regulating pathway mlk04213   Longevity regulating pathway - multiple species mlk04218   Cellular senescence mlk04360   Axon guidance mlk04370   VEGF signaling pathway mlk04371   Apelin signaling pathway mlk04540   Gap junction mlk04550   Signaling pathways regulating pluripotency of stem cells mlk04625   C-type lectin receptor signaling pathway mlk04650   Natural killer cell mediated cytotoxicity mlk04660   T cell receptor signaling pathway mlk04662   B cell receptor signaling pathway mlk04664   Fc epsilon RI signaling pathway mlk04714   Thermogenesis mlk04720   Long-term potentiation mlk04722   Neurotrophin signaling pathway mlk04725   Cholinergic synapse mlk04726   Serotonergic synapse mlk04730   Long-term depression mlk04810   Regulation of actin cytoskeleton mlk04910   Insulin signaling pathway mlk04912   GnRH signaling pathway mlk04915   Estrogen signaling pathway mlk04916   Melanogenesis mlk04917   Prolactin signaling pathway mlk04919   Thyroid hormone signaling pathway mlk04921   Oxytocin signaling pathway mlk04926   Relaxin signaling pathway mlk04929   GnRH secretion mlk04933   AGE-RAGE signaling pathway in diabetic complications mlk04935   Growth hormone synthesis, secretion and action mlk05010   Alzheimer disease mlk05022   Pathways of neurodegeneration - multiple diseases mlk05034   Alcoholism mlk05160   Hepatitis C mlk05161   Hepatitis B mlk05163   Human cytomegalovirus infection mlk05165   Human papillomavirus infection mlk05166   Human T-cell leukemia virus 1 infection mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05170   Human immunodeficiency virus 1 infection mlk05200   Pathways in cancer mlk05203   Viral carcinogenesis mlk05205   Proteoglycans in cancer mlk05206   MicroRNAs in cancer mlk05207   Chemical carcinogenesis - receptor activation mlk05208   Chemical carcinogenesis - reactive oxygen species mlk05210   Colorectal cancer mlk05211   Renal cell carcinoma mlk05213   Endometrial cancer mlk05214   Glioma mlk05215   Prostate cancer mlk05216   Thyroid cancer mlk05218   Melanoma mlk05219   Bladder cancer mlk05220   Chronic myeloid leukemia mlk05221   Acute myeloid leukemia mlk05223   Non-small cell lung cancer mlk05224   Breast cancer mlk05225   Hepatocellular carcinoma mlk05226   Gastric cancer mlk05230   Central carbon metabolism in cancer mlk05231   Choline metabolism in cancer mlk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131810307 (NRAS)    04012 ErbB signaling pathway     131810307 (NRAS)    04014 Ras signaling pathway     131810307 (NRAS)    04015 Rap1 signaling pathway     131810307 (NRAS)    04370 VEGF signaling pathway     131810307 (NRAS)    04371 Apelin signaling pathway     131810307 (NRAS)    04068 FoxO signaling pathway     131810307 (NRAS)    04072 Phospholipase D signaling pathway     131810307 (NRAS)    04071 Sphingolipid signaling pathway     131810307 (NRAS)    04151 PI3K-Akt signaling pathway     131810307 (NRAS)    04150 mTOR signaling pathway     131810307 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131810307 (NRAS)    04137 Mitophagy - animal     131810307 (NRAS)   09143 Cell growth and death    04210 Apoptosis     131810307 (NRAS)    04218 Cellular senescence     131810307 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     131810307 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     131810307 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     131810307 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131810307 (NRAS)    04650 Natural killer cell mediated cytotoxicity     131810307 (NRAS)    04660 T cell receptor signaling pathway     131810307 (NRAS)    04662 B cell receptor signaling pathway     131810307 (NRAS)    04664 Fc epsilon RI signaling pathway     131810307 (NRAS)    04062 Chemokine signaling pathway     131810307 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     131810307 (NRAS)    04929 GnRH secretion     131810307 (NRAS)    04912 GnRH signaling pathway     131810307 (NRAS)    04915 Estrogen signaling pathway     131810307 (NRAS)    04917 Prolactin signaling pathway     131810307 (NRAS)    04921 Oxytocin signaling pathway     131810307 (NRAS)    04926 Relaxin signaling pathway     131810307 (NRAS)    04935 Growth hormone synthesis, secretion and action     131810307 (NRAS)    04919 Thyroid hormone signaling pathway     131810307 (NRAS)    04916 Melanogenesis     131810307 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     131810307 (NRAS)    04726 Serotonergic synapse     131810307 (NRAS)    04720 Long-term potentiation     131810307 (NRAS)    04730 Long-term depression     131810307 (NRAS)    04722 Neurotrophin signaling pathway     131810307 (NRAS)   09158 Development and regeneration    04360 Axon guidance     131810307 (NRAS)   09149 Aging    04211 Longevity regulating pathway     131810307 (NRAS)    04213 Longevity regulating pathway - multiple species     131810307 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     131810307 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131810307 (NRAS)    05206 MicroRNAs in cancer     131810307 (NRAS)    05205 Proteoglycans in cancer     131810307 (NRAS)    05207 Chemical carcinogenesis - receptor activation     131810307 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     131810307 (NRAS)    05203 Viral carcinogenesis     131810307 (NRAS)    05230 Central carbon metabolism in cancer     131810307 (NRAS)    05231 Choline metabolism in cancer     131810307 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     131810307 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     131810307 (NRAS)    05225 Hepatocellular carcinoma     131810307 (NRAS)    05226 Gastric cancer     131810307 (NRAS)    05214 Glioma     131810307 (NRAS)    05216 Thyroid cancer     131810307 (NRAS)    05221 Acute myeloid leukemia     131810307 (NRAS)    05220 Chronic myeloid leukemia     131810307 (NRAS)    05218 Melanoma     131810307 (NRAS)    05211 Renal cell carcinoma     131810307 (NRAS)    05219 Bladder cancer     131810307 (NRAS)    05215 Prostate cancer     131810307 (NRAS)    05213 Endometrial cancer     131810307 (NRAS)    05224 Breast cancer     131810307 (NRAS)    05223 Non-small cell lung cancer     131810307 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     131810307 (NRAS)    05170 Human immunodeficiency virus 1 infection     131810307 (NRAS)    05161 Hepatitis B     131810307 (NRAS)    05160 Hepatitis C     131810307 (NRAS)    05163 Human cytomegalovirus infection     131810307 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     131810307 (NRAS)    05165 Human papillomavirus infection     131810307 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     131810307 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     131810307 (NRAS)   09165 Substance dependence    05034 Alcoholism     131810307 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131810307 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     131810307 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     131810307 (NRAS)    01522 Endocrine resistance     131810307 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlk04131]     131810307 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlk04147]     131810307 (NRAS)    04031 GTP-binding proteins [BR:mlk04031]     131810307 (NRAS) Membrane trafficking [BR:mlk04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     131810307 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     131810307 (NRAS) Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131810307 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    131810307 (NRAS)   Exosomal proteins of breast cancer cells    131810307 (NRAS)   Exosomal proteins of colorectal cancer cells    131810307 (NRAS) GTP-binding proteins [BR:mlk04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     131810307 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  131810307 NCBI-ProteinID:  XP_058994056 LinkDB All DBs Position 10:complement(98150823..98161056) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctggt caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt aagcgagtaaaagattcagatgatgtacctatggtgctagtaggaaataagtgtgatttg ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaatagcagtgatgatggaactcaaggt tgtatggggttaccttgtgtggtgatgtaa

DBGET integrated database retrieval system