KEGG   Mustela lutreola (European mink): 131811758
Entry
131811758         CDS       T09578                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mlk  Mustela lutreola (European mink)
Pathway
mlk01521  EGFR tyrosine kinase inhibitor resistance
mlk01522  Endocrine resistance
mlk01524  Platinum drug resistance
mlk04010  MAPK signaling pathway
mlk04012  ErbB signaling pathway
mlk04014  Ras signaling pathway
mlk04015  Rap1 signaling pathway
mlk04022  cGMP-PKG signaling pathway
mlk04024  cAMP signaling pathway
mlk04062  Chemokine signaling pathway
mlk04066  HIF-1 signaling pathway
mlk04068  FoxO signaling pathway
mlk04071  Sphingolipid signaling pathway
mlk04072  Phospholipase D signaling pathway
mlk04114  Oocyte meiosis
mlk04140  Autophagy - animal
mlk04148  Efferocytosis
mlk04150  mTOR signaling pathway
mlk04151  PI3K-Akt signaling pathway
mlk04210  Apoptosis
mlk04218  Cellular senescence
mlk04261  Adrenergic signaling in cardiomyocytes
mlk04270  Vascular smooth muscle contraction
mlk04350  TGF-beta signaling pathway
mlk04360  Axon guidance
mlk04370  VEGF signaling pathway
mlk04371  Apelin signaling pathway
mlk04380  Osteoclast differentiation
mlk04510  Focal adhesion
mlk04520  Adherens junction
mlk04540  Gap junction
mlk04550  Signaling pathways regulating pluripotency of stem cells
mlk04611  Platelet activation
mlk04613  Neutrophil extracellular trap formation
mlk04620  Toll-like receptor signaling pathway
mlk04621  NOD-like receptor signaling pathway
mlk04625  C-type lectin receptor signaling pathway
mlk04650  Natural killer cell mediated cytotoxicity
mlk04657  IL-17 signaling pathway
mlk04658  Th1 and Th2 cell differentiation
mlk04659  Th17 cell differentiation
mlk04660  T cell receptor signaling pathway
mlk04662  B cell receptor signaling pathway
mlk04664  Fc epsilon RI signaling pathway
mlk04666  Fc gamma R-mediated phagocytosis
mlk04668  TNF signaling pathway
mlk04713  Circadian entrainment
mlk04720  Long-term potentiation
mlk04722  Neurotrophin signaling pathway
mlk04723  Retrograde endocannabinoid signaling
mlk04724  Glutamatergic synapse
mlk04725  Cholinergic synapse
mlk04726  Serotonergic synapse
mlk04730  Long-term depression
mlk04810  Regulation of actin cytoskeleton
mlk04910  Insulin signaling pathway
mlk04912  GnRH signaling pathway
mlk04914  Progesterone-mediated oocyte maturation
mlk04915  Estrogen signaling pathway
mlk04916  Melanogenesis
mlk04917  Prolactin signaling pathway
mlk04919  Thyroid hormone signaling pathway
mlk04921  Oxytocin signaling pathway
mlk04926  Relaxin signaling pathway
mlk04928  Parathyroid hormone synthesis, secretion and action
mlk04929  GnRH secretion
mlk04930  Type II diabetes mellitus
mlk04933  AGE-RAGE signaling pathway in diabetic complications
mlk04934  Cushing syndrome
mlk04935  Growth hormone synthesis, secretion and action
mlk04960  Aldosterone-regulated sodium reabsorption
mlk05010  Alzheimer disease
mlk05020  Prion disease
mlk05022  Pathways of neurodegeneration - multiple diseases
mlk05034  Alcoholism
mlk05132  Salmonella infection
mlk05133  Pertussis
mlk05135  Yersinia infection
mlk05140  Leishmaniasis
mlk05142  Chagas disease
mlk05145  Toxoplasmosis
mlk05152  Tuberculosis
mlk05160  Hepatitis C
mlk05161  Hepatitis B
mlk05163  Human cytomegalovirus infection
mlk05164  Influenza A
mlk05165  Human papillomavirus infection
mlk05166  Human T-cell leukemia virus 1 infection
mlk05167  Kaposi sarcoma-associated herpesvirus infection
mlk05170  Human immunodeficiency virus 1 infection
mlk05171  Coronavirus disease - COVID-19
mlk05200  Pathways in cancer
mlk05203  Viral carcinogenesis
mlk05205  Proteoglycans in cancer
mlk05206  MicroRNAs in cancer
mlk05207  Chemical carcinogenesis - receptor activation
mlk05208  Chemical carcinogenesis - reactive oxygen species
mlk05210  Colorectal cancer
mlk05211  Renal cell carcinoma
mlk05212  Pancreatic cancer
mlk05213  Endometrial cancer
mlk05214  Glioma
mlk05215  Prostate cancer
mlk05216  Thyroid cancer
mlk05218  Melanoma
mlk05219  Bladder cancer
mlk05220  Chronic myeloid leukemia
mlk05221  Acute myeloid leukemia
mlk05223  Non-small cell lung cancer
mlk05224  Breast cancer
mlk05225  Hepatocellular carcinoma
mlk05226  Gastric cancer
mlk05230  Central carbon metabolism in cancer
mlk05231  Choline metabolism in cancer
mlk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mlk05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mlk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    131811758 (MAPK1)
   04012 ErbB signaling pathway
    131811758 (MAPK1)
   04014 Ras signaling pathway
    131811758 (MAPK1)
   04015 Rap1 signaling pathway
    131811758 (MAPK1)
   04350 TGF-beta signaling pathway
    131811758 (MAPK1)
   04370 VEGF signaling pathway
    131811758 (MAPK1)
   04371 Apelin signaling pathway
    131811758 (MAPK1)
   04668 TNF signaling pathway
    131811758 (MAPK1)
   04066 HIF-1 signaling pathway
    131811758 (MAPK1)
   04068 FoxO signaling pathway
    131811758 (MAPK1)
   04072 Phospholipase D signaling pathway
    131811758 (MAPK1)
   04071 Sphingolipid signaling pathway
    131811758 (MAPK1)
   04024 cAMP signaling pathway
    131811758 (MAPK1)
   04022 cGMP-PKG signaling pathway
    131811758 (MAPK1)
   04151 PI3K-Akt signaling pathway
    131811758 (MAPK1)
   04150 mTOR signaling pathway
    131811758 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    131811758 (MAPK1)
   04148 Efferocytosis
    131811758 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    131811758 (MAPK1)
   04210 Apoptosis
    131811758 (MAPK1)
   04218 Cellular senescence
    131811758 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    131811758 (MAPK1)
   04520 Adherens junction
    131811758 (MAPK1)
   04540 Gap junction
    131811758 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    131811758 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    131811758 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    131811758 (MAPK1)
   04613 Neutrophil extracellular trap formation
    131811758 (MAPK1)
   04620 Toll-like receptor signaling pathway
    131811758 (MAPK1)
   04621 NOD-like receptor signaling pathway
    131811758 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    131811758 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    131811758 (MAPK1)
   04660 T cell receptor signaling pathway
    131811758 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    131811758 (MAPK1)
   04659 Th17 cell differentiation
    131811758 (MAPK1)
   04657 IL-17 signaling pathway
    131811758 (MAPK1)
   04662 B cell receptor signaling pathway
    131811758 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    131811758 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    131811758 (MAPK1)
   04062 Chemokine signaling pathway
    131811758 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    131811758 (MAPK1)
   04929 GnRH secretion
    131811758 (MAPK1)
   04912 GnRH signaling pathway
    131811758 (MAPK1)
   04915 Estrogen signaling pathway
    131811758 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    131811758 (MAPK1)
   04917 Prolactin signaling pathway
    131811758 (MAPK1)
   04921 Oxytocin signaling pathway
    131811758 (MAPK1)
   04926 Relaxin signaling pathway
    131811758 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    131811758 (MAPK1)
   04919 Thyroid hormone signaling pathway
    131811758 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    131811758 (MAPK1)
   04916 Melanogenesis
    131811758 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    131811758 (MAPK1)
   04270 Vascular smooth muscle contraction
    131811758 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    131811758 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    131811758 (MAPK1)
   04725 Cholinergic synapse
    131811758 (MAPK1)
   04726 Serotonergic synapse
    131811758 (MAPK1)
   04720 Long-term potentiation
    131811758 (MAPK1)
   04730 Long-term depression
    131811758 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    131811758 (MAPK1)
   04722 Neurotrophin signaling pathway
    131811758 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    131811758 (MAPK1)
   04380 Osteoclast differentiation
    131811758 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    131811758 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    131811758 (MAPK1)
   05206 MicroRNAs in cancer
    131811758 (MAPK1)
   05205 Proteoglycans in cancer
    131811758 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    131811758 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    131811758 (MAPK1)
   05203 Viral carcinogenesis
    131811758 (MAPK1)
   05230 Central carbon metabolism in cancer
    131811758 (MAPK1)
   05231 Choline metabolism in cancer
    131811758 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    131811758 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    131811758 (MAPK1)
   05212 Pancreatic cancer
    131811758 (MAPK1)
   05225 Hepatocellular carcinoma
    131811758 (MAPK1)
   05226 Gastric cancer
    131811758 (MAPK1)
   05214 Glioma
    131811758 (MAPK1)
   05216 Thyroid cancer
    131811758 (MAPK1)
   05221 Acute myeloid leukemia
    131811758 (MAPK1)
   05220 Chronic myeloid leukemia
    131811758 (MAPK1)
   05218 Melanoma
    131811758 (MAPK1)
   05211 Renal cell carcinoma
    131811758 (MAPK1)
   05219 Bladder cancer
    131811758 (MAPK1)
   05215 Prostate cancer
    131811758 (MAPK1)
   05213 Endometrial cancer
    131811758 (MAPK1)
   05224 Breast cancer
    131811758 (MAPK1)
   05223 Non-small cell lung cancer
    131811758 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    131811758 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    131811758 (MAPK1)
   05161 Hepatitis B
    131811758 (MAPK1)
   05160 Hepatitis C
    131811758 (MAPK1)
   05171 Coronavirus disease - COVID-19
    131811758 (MAPK1)
   05164 Influenza A
    131811758 (MAPK1)
   05163 Human cytomegalovirus infection
    131811758 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    131811758 (MAPK1)
   05165 Human papillomavirus infection
    131811758 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    131811758 (MAPK1)
   05135 Yersinia infection
    131811758 (MAPK1)
   05133 Pertussis
    131811758 (MAPK1)
   05152 Tuberculosis
    131811758 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    131811758 (MAPK1)
   05140 Leishmaniasis
    131811758 (MAPK1)
   05142 Chagas disease
    131811758 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    131811758 (MAPK1)
   05020 Prion disease
    131811758 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    131811758 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    131811758 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    131811758 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    131811758 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    131811758 (MAPK1)
   04934 Cushing syndrome
    131811758 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    131811758 (MAPK1)
   01524 Platinum drug resistance
    131811758 (MAPK1)
   01522 Endocrine resistance
    131811758 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mlk01001]
    131811758 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mlk03036]
    131811758 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlk04147]
    131811758 (MAPK1)
Enzymes [BR:mlk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     131811758 (MAPK1)
Protein kinases [BR:mlk01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   131811758 (MAPK1)
Chromosome and associated proteins [BR:mlk03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     131811758 (MAPK1)
Exosome [BR:mlk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   131811758 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 131811758
NCBI-ProteinID: XP_058996529
LinkDB
Position
11:complement(64133226..64241465)
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgat
gtggggccgcgctacaccaacctctcgtacatcggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgaa
caccaaacctactgccagagaaccctgagggagataaaaatcttactgcgcttcagacat
gagaacatcattggaatcaatgacattattcgagcaccaaccattgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacgcaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaatgtactgcatcgtgacctcaaaccttccaacctgctgctcaacaccacc
tgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccagaccatgatcac
acagggttcctgacggagtatgtagccacacgttggtacagggctccagaaatcatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctgtccaacaggcccatcttccctgggaagcattatctcgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaactgtataataaatttaaaagct
agaaactacttgctttctcttccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgattccaaagctctggatttactggacaaaatgttgacattcaaccctcacaag
aggattgaagtagaacaggctctggcccatccgtatctggagcagtattatgacccaagc
gatgagcccattgccgaggcgccattcaagtttgacatggagctggacgacctgcccaag
gaaaagctcaaagagctcatcttcgaagagacagctagattccagccgggatacagatct
taa

DBGET integrated database retrieval system