Mustela lutreola (European mink): 131812618 Help Entry 131812618         CDS       T09578                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism mlk  Mustela lutreola (European mink) Pathway mlk04060   Cytokine-cytokine receptor interaction mlk04151   PI3K-Akt signaling pathway mlk04217   Necroptosis mlk04620   Toll-like receptor signaling pathway mlk04621   NOD-like receptor signaling pathway mlk04622   RIG-I-like receptor signaling pathway mlk04623   Cytosolic DNA-sensing pathway mlk04630   JAK-STAT signaling pathway mlk04650   Natural killer cell mediated cytotoxicity mlk04936   Alcoholic liver disease mlk05152   Tuberculosis mlk05160   Hepatitis C mlk05161   Hepatitis B mlk05162   Measles mlk05163   Human cytomegalovirus infection mlk05164   Influenza A mlk05165   Human papillomavirus infection mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05168   Herpes simplex virus 1 infection mlk05169   Epstein-Barr virus infection mlk05170   Human immunodeficiency virus 1 infection mlk05171   Coronavirus disease - COVID-19 mlk05200   Pathways in cancer mlk05320   Autoimmune thyroid disease mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     131812618    04151 PI3K-Akt signaling pathway     131812618   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131812618  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     131812618  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131812618    04621 NOD-like receptor signaling pathway     131812618    04622 RIG-I-like receptor signaling pathway     131812618    04623 Cytosolic DNA-sensing pathway     131812618    04650 Natural killer cell mediated cytotoxicity     131812618  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131812618   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     131812618    05161 Hepatitis B     131812618    05160 Hepatitis C     131812618    05171 Coronavirus disease - COVID-19     131812618    05164 Influenza A     131812618    05162 Measles     131812618    05168 Herpes simplex virus 1 infection     131812618    05163 Human cytomegalovirus infection     131812618    05167 Kaposi sarcoma-associated herpesvirus infection     131812618    05169 Epstein-Barr virus infection     131812618    05165 Human papillomavirus infection     131812618   09171 Infectious disease: bacterial    05152 Tuberculosis     131812618   09163 Immune disease    05320 Autoimmune thyroid disease     131812618   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131812618   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     131812618  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131812618 Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Interferons    131812618 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon PORR Motif Other DBs NCBI-GeneID:  131812618 NCBI-ProteinID:  XP_058998366 LinkDB All DBs Position 12:complement(47709815..47710378) Genome browser AA seq 187 aa AA seqDB search MALSYSFLVALLVLSCHSLGSLGCDLPQNHGLLQWRALMLLRQMRRLSASSCDNYTNDFG FPQEVFDSKALQKSHALSVVHVMNQKTFHLFCTEASPAPWNTTLLEELCSGLSEQLDRLA ACPLLEVGVGELPVVNRDSILRNYFQRISLYLQEKQYSPCAWEMVRAEIMKPLYASIALH KRLRSGK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggcactatcctattccttcttggtggccctgttggtgctcagctgccactcccttggc tctctgggatgtgacctgcctcagaaccatggcctgctgcagtggagggccctgatgctc ctgcgacaaatgaggagactgtctgctagctcctgtgacaactatacaaacgactttggc ttcccacaggaggtgtttgacagcaaggcgctacagaagtctcacgccctctctgttgtc catgtgatgaaccagaaaaccttccacctcttctgcacagaggcctcacctgctccttgg aacacgaccctcctggaggaattgtgctcaggactttctgagcagctggatcgcctggca gcctgtcctctgctggaggtgggggtaggagagctgcccgtggtgaacagggactccatc ctgaggaactacttccagagaatctccctctatctgcaagagaagcaatacagcccttgt gcctgggagatggtccgagcagagatcatgaaacccttgtatgcatcaatagccttacat aagagactaaggagcgggaagtga

DBGET integrated database retrieval system