Mustela lutreola (European mink): 131812695 Help Entry 131812695         CDS       T09578                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism mlk  Mustela lutreola (European mink) Pathway mlk04010   MAPK signaling pathway mlk04020   Calcium signaling pathway mlk04022   cGMP-PKG signaling pathway mlk04114   Oocyte meiosis mlk04218   Cellular senescence mlk04310   Wnt signaling pathway mlk04360   Axon guidance mlk04370   VEGF signaling pathway mlk04380   Osteoclast differentiation mlk04625   C-type lectin receptor signaling pathway mlk04650   Natural killer cell mediated cytotoxicity mlk04658   Th1 and Th2 cell differentiation mlk04659   Th17 cell differentiation mlk04660   T cell receptor signaling pathway mlk04662   B cell receptor signaling pathway mlk04720   Long-term potentiation mlk04724   Glutamatergic synapse mlk04921   Oxytocin signaling pathway mlk04922   Glucagon signaling pathway mlk04924   Renin secretion mlk05010   Alzheimer disease mlk05014   Amyotrophic lateral sclerosis mlk05020   Prion disease mlk05022   Pathways of neurodegeneration - multiple diseases mlk05031   Amphetamine addiction mlk05152   Tuberculosis mlk05163   Human cytomegalovirus infection mlk05166   Human T-cell leukemia virus 1 infection mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05170   Human immunodeficiency virus 1 infection mlk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131812695 (PPP3R2)    04310 Wnt signaling pathway     131812695 (PPP3R2)    04370 VEGF signaling pathway     131812695 (PPP3R2)    04020 Calcium signaling pathway     131812695 (PPP3R2)    04022 cGMP-PKG signaling pathway     131812695 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     131812695 (PPP3R2)    04218 Cellular senescence     131812695 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131812695 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     131812695 (PPP3R2)    04660 T cell receptor signaling pathway     131812695 (PPP3R2)    04658 Th1 and Th2 cell differentiation     131812695 (PPP3R2)    04659 Th17 cell differentiation     131812695 (PPP3R2)    04662 B cell receptor signaling pathway     131812695 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     131812695 (PPP3R2)    04921 Oxytocin signaling pathway     131812695 (PPP3R2)    04924 Renin secretion     131812695 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     131812695 (PPP3R2)    04720 Long-term potentiation     131812695 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     131812695 (PPP3R2)    04380 Osteoclast differentiation     131812695 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     131812695 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     131812695 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     131812695 (PPP3R2)    05163 Human cytomegalovirus infection     131812695 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     131812695 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     131812695 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     131812695 (PPP3R2)    05014 Amyotrophic lateral sclerosis     131812695 (PPP3R2)    05020 Prion disease     131812695 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     131812695 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     131812695 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131812695 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mlk01009]     131812695 (PPP3R2) Protein phosphatases and associated proteins [BR:mlk01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      131812695 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 flgK_1st_1 Toprim_3 Motif Other DBs NCBI-GeneID:  131812695 NCBI-ProteinID:  XP_058998527 LinkDB All DBs Position 12:29733077..29734060 Genome browser AA seq 170 aa AA seqDB search MGNEASYPEEICSHFSSDEIKRLSKRFKKLDLDRSGSLSVEEFVSLPELHQNPLVQRVID VFDTDGNGEVNFKEFILGTSQFSVRGDEEEKLRFAFSIYDIDKDGYISNGELFQVLKLMV GDNLEDWQLQQLVDKTIIVLDRDGDGKISFEEFSAVVRGLDVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggagatatgctcccacttcagctccgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggaccgttcaggctctctgagtgtg gaggagttcgtgtccctgcccgagctgcaccagaacccgttggtgcagcgagtgatcgac gtcttcgacaccgacggcaatggagaagtgaacttcaaggagttcatcctggggacctcc cagttcagcgtcaggggggacgaggaggagaagttgaggtttgccttcagcatctatgac attgataaagatggctacatttccaacggggagctcttccaggtgctgaagctgatggtg ggcgacaacctggaggactggcagttacagcagttagtggacaaaaccatcatcgtcctg gatcgggatggagacgggaaaatatcctttgaggagttcagcgctgtggttagaggcctg gatgtccacaagaagttggtggtgattgtgtga

DBGET integrated database retrieval system