Mustela lutreola (European mink): 131814449 Help Entry 131814449         CDS       T09578                                  Name (RefSeq) claudin-6-like   KO K06087   claudin Organism mlk  Mustela lutreola (European mink) Pathway mlk03272   Virion - Hepatitis viruses mlk04382   Cornified envelope formation mlk04514   Cell adhesion molecule (CAM) interaction mlk04530   Tight junction mlk04670   Leukocyte transendothelial migration mlk05160   Hepatitis C Brite KEGG Orthology (KO) [BR:mlk00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     131814449  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     131814449  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     131814449  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     131814449   09158 Development and regeneration    04382 Cornified envelope formation     131814449  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     131814449  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mlk03037]     131814449    04147 Exosome [BR:mlk04147]     131814449 Cilium and associated proteins [BR:mlk03037]  Other cilia and associated proteins   Stereociliary proteins    131814449 Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    131814449   Exosomal proteins of colorectal cancer cells    131814449 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  131814449 NCBI-ProteinID:  XP_059001372 LinkDB All DBs Position 14:35310210..35310668 Genome browser AA seq 152 aa AA seqDB search MASTGLQILRIILMLLGWVNALLSCALALWKVTAFISNITMAAQVVWEELQMSCMVQSTG QMQCMVYAPLLVLPQDQQTARDHPPVGSAWSVGYVEDKDSKGHLVIFSEIIFIISGILPR SPSAASPHNHVGLLQPPGGQGPKVGGGAFYLG NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcttccactggtctacaaatcctgaggatcatcctaatgctgcttggctgggtgaat gctctgctttcctgtgccctggccctatggaaagtgactgccttcatcagcaacatcact atggcagcccaggtggtgtgggaggagctgcagatgtcctgcatggtgcagagcacaggt cagatgcagtgcatggtatacgccccactgctcgtgctgccccaggaccagcagactgct cgtgatcatcctcctgttggctctgcttggtctgttggttacgtggaagacaaggactcc aagggccatttggtgattttctctgagatcatctttatcatctcagggatcctgcccaga tccccatctgctgccagcccacacaaccatgtaggacttctacaacccccaggtggccaa ggcccaaaagtaggaggtggggccttctacctgggctga

DBGET integrated database retrieval system