Mustela lutreola (European mink): 131814720 Help Entry 131814720         CDS       T09578                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism mlk  Mustela lutreola (European mink) Pathway mlk04613   Neutrophil extracellular trap formation mlk05034   Alcoholism mlk05202   Transcriptional misregulation in cancer mlk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     131814720  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     131814720   09163 Immune disease    05322 Systemic lupus erythematosus     131814720   09165 Substance dependence    05034 Alcoholism     131814720  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlk03036]     131814720   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlk04147]     131814720 Chromosome and associated proteins [BR:mlk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131814720 Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131814720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  131814720 NCBI-ProteinID:  XP_059001928 LinkDB All DBs Position 14:complement(36679332..36688189) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcaaactgcccgcaaatcgaccgggggtaaagctccaaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctaccggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggtgggcctctttgaagacaccaacctgtgtgctatccatgccaaacgtgtcacaatt atgccaaaagacatccagctagcgcgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system