Mustela lutreola (European mink): 131816155 Help Entry 131816155         CDS       T09578                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism mlk  Mustela lutreola (European mink) Pathway mlk04060   Cytokine-cytokine receptor interaction mlk04061   Viral protein interaction with cytokine and cytokine receptor mlk04062   Chemokine signaling pathway mlk04621   NOD-like receptor signaling pathway mlk04657   IL-17 signaling pathway mlk04668   TNF signaling pathway mlk04933   AGE-RAGE signaling pathway in diabetic complications mlk05135   Yersinia infection mlk05142   Chagas disease mlk05144   Malaria mlk05163   Human cytomegalovirus infection mlk05164   Influenza A mlk05168   Herpes simplex virus 1 infection mlk05171   Coronavirus disease - COVID-19 mlk05323   Rheumatoid arthritis mlk05417   Lipid and atherosclerosis mlk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     131816155   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131816155    04061 Viral protein interaction with cytokine and cytokine receptor     131816155  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     131816155    04657 IL-17 signaling pathway     131816155    04062 Chemokine signaling pathway     131816155  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     131816155    05164 Influenza A     131816155    05168 Herpes simplex virus 1 infection     131816155    05163 Human cytomegalovirus infection     131816155   09171 Infectious disease: bacterial    05135 Yersinia infection     131816155   09174 Infectious disease: parasitic    05144 Malaria     131816155    05142 Chagas disease     131816155   09163 Immune disease    05323 Rheumatoid arthritis     131816155   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131816155    05418 Fluid shear stress and atherosclerosis     131816155   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     131816155  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131816155    00536 Glycosaminoglycan binding proteins [BR:mlk00536]     131816155 Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Chemokines    131816155 Glycosaminoglycan binding proteins [BR:mlk00536]  Heparan sulfate / Heparin   Chemokines    131816155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  131816155 NCBI-ProteinID:  XP_059004575 LinkDB All DBs Position 15:complement(38464487..38466447) Genome browser AA seq 101 aa AA seqDB search MKVSATLLCLLLTTAAISIQVLAQPDAINSPVTCCYTFTNKKISVQRLVSYKRVTSSKCP KEAVILKTFLNKEICADPSQKWVRDSMAHLDKKTQTQTAKP NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgccacacttctctgcctgctgctcacgactgccgccatcagcatccag gtgctcgcccagccagatgcaattaattctccggtcacctgctgctatacattcaccaat aagaagatctcagtgcagaggctggtgagctataagagagtcaccagcagcaagtgtccc aaagaagctgtgatcctcaagacattccttaacaaggagatctgcgctgaccccagtcag aagtgggtccgggattccatggcacacctggacaagaaaacccagacccaaactgcaaag ccatga

DBGET integrated database retrieval system