Mustela lutreola (European mink): 131816225 Help Entry 131816225         CDS       T09578                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism mlk  Mustela lutreola (European mink) Pathway mlk04014   Ras signaling pathway mlk04137   Mitophagy - animal mlk04144   Endocytosis mlk04145   Phagosome mlk04148   Efferocytosis mlk04962   Vasopressin-regulated water reabsorption mlk05132   Salmonella infection mlk05146   Amoebiasis mlk05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     131816225 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     131816225 (RAB5C)    04145 Phagosome     131816225 (RAB5C)    04137 Mitophagy - animal     131816225 (RAB5C)    04148 Efferocytosis     131816225 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     131816225 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131816225 (RAB5C)    05152 Tuberculosis     131816225 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     131816225 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlk04131]     131816225 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlk04147]     131816225 (RAB5C)    04031 GTP-binding proteins [BR:mlk04031]     131816225 (RAB5C) Membrane trafficking [BR:mlk04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     131816225 (RAB5C)  Endosome - Lysosome transport     131816225 (RAB5C) Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131816225 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    131816225 (RAB5C)   Exosomal proteins of colorectal cancer cells    131816225 (RAB5C)   Exosomal proteins of bladder cancer cells    131816225 (RAB5C) GTP-binding proteins [BR:mlk04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     131816225 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  131816225 NCBI-ProteinID:  XP_059004732 LinkDB All DBs Position 15:20097715..20122281 Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPSRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcgcgacccaacggaccagctgctgggaacaagatctgt cagtttaagctggtcctgctgggggagtccgcggtgggcaaatctagcctcgtcctccgc tttgtcaagggacagttccacgagtatcaggagagcacaattggagcggccttcctcaca cagacagtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tatgacatcaccaacacagacacgtttgcacgggccaagaactgggtgaaggagctacag aggcaggccagccccaacatcgtcatcgcgctcgcggggaacaaggcggacctggccagc aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc atggagacatcagcaaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag aagcttcccaagaatgagccccagaatgcagcgggtgctccgagccggaaccgaggtgtg gacctgcaggagaacaacccagccagccggagccagtgttgcagcaactga

DBGET integrated database retrieval system