Mustela lutreola (European mink): 131817775 Help Entry 131817775         CDS       T09578                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism mlk  Mustela lutreola (European mink) Pathway mlk01521   EGFR tyrosine kinase inhibitor resistance mlk01522   Endocrine resistance mlk01524   Platinum drug resistance mlk04071   Sphingolipid signaling pathway mlk04115   p53 signaling pathway mlk04141   Protein processing in endoplasmic reticulum mlk04210   Apoptosis mlk04211   Longevity regulating pathway mlk04215   Apoptosis - multiple species mlk04217   Necroptosis mlk04722   Neurotrophin signaling pathway mlk04932   Non-alcoholic fatty liver disease mlk04933   AGE-RAGE signaling pathway in diabetic complications mlk05012   Parkinson disease mlk05014   Amyotrophic lateral sclerosis mlk05016   Huntington disease mlk05020   Prion disease mlk05022   Pathways of neurodegeneration - multiple diseases mlk05132   Salmonella infection mlk05152   Tuberculosis mlk05160   Hepatitis C mlk05161   Hepatitis B mlk05162   Measles mlk05163   Human cytomegalovirus infection mlk05164   Influenza A mlk05165   Human papillomavirus infection mlk05166   Human T-cell leukemia virus 1 infection mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05168   Herpes simplex virus 1 infection mlk05169   Epstein-Barr virus infection mlk05170   Human immunodeficiency virus 1 infection mlk05200   Pathways in cancer mlk05202   Transcriptional misregulation in cancer mlk05203   Viral carcinogenesis mlk05210   Colorectal cancer mlk05212   Pancreatic cancer mlk05213   Endometrial cancer mlk05214   Glioma mlk05216   Thyroid cancer mlk05217   Basal cell carcinoma mlk05218   Melanoma mlk05220   Chronic myeloid leukemia mlk05222   Small cell lung cancer mlk05223   Non-small cell lung cancer mlk05224   Breast cancer mlk05225   Hepatocellular carcinoma mlk05226   Gastric cancer mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131817775 (BAX)  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     131817775 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     131817775 (BAX)    04215 Apoptosis - multiple species     131817775 (BAX)    04217 Necroptosis     131817775 (BAX)    04115 p53 signaling pathway     131817775 (BAX)  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     131817775 (BAX)   09149 Aging    04211 Longevity regulating pathway     131817775 (BAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131817775 (BAX)    05202 Transcriptional misregulation in cancer     131817775 (BAX)    05203 Viral carcinogenesis     131817775 (BAX)   09162 Cancer: specific types    05210 Colorectal cancer     131817775 (BAX)    05212 Pancreatic cancer     131817775 (BAX)    05225 Hepatocellular carcinoma     131817775 (BAX)    05226 Gastric cancer     131817775 (BAX)    05214 Glioma     131817775 (BAX)    05216 Thyroid cancer     131817775 (BAX)    05220 Chronic myeloid leukemia     131817775 (BAX)    05217 Basal cell carcinoma     131817775 (BAX)    05218 Melanoma     131817775 (BAX)    05213 Endometrial cancer     131817775 (BAX)    05224 Breast cancer     131817775 (BAX)    05222 Small cell lung cancer     131817775 (BAX)    05223 Non-small cell lung cancer     131817775 (BAX)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     131817775 (BAX)    05170 Human immunodeficiency virus 1 infection     131817775 (BAX)    05161 Hepatitis B     131817775 (BAX)    05160 Hepatitis C     131817775 (BAX)    05164 Influenza A     131817775 (BAX)    05162 Measles     131817775 (BAX)    05168 Herpes simplex virus 1 infection     131817775 (BAX)    05163 Human cytomegalovirus infection     131817775 (BAX)    05167 Kaposi sarcoma-associated herpesvirus infection     131817775 (BAX)    05169 Epstein-Barr virus infection     131817775 (BAX)    05165 Human papillomavirus infection     131817775 (BAX)   09171 Infectious disease: bacterial    05132 Salmonella infection     131817775 (BAX)    05152 Tuberculosis     131817775 (BAX)   09164 Neurodegenerative disease    05012 Parkinson disease     131817775 (BAX)    05014 Amyotrophic lateral sclerosis     131817775 (BAX)    05016 Huntington disease     131817775 (BAX)    05020 Prion disease     131817775 (BAX)    05022 Pathways of neurodegeneration - multiple diseases     131817775 (BAX)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131817775 (BAX)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     131817775 (BAX)    04933 AGE-RAGE signaling pathway in diabetic complications     131817775 (BAX)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     131817775 (BAX)    01524 Platinum drug resistance     131817775 (BAX)    01522 Endocrine resistance     131817775 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mlk03029]     131817775 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mlk02000]     131817775 (BAX) Mitochondrial biogenesis [BR:mlk03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     131817775 (BAX) Transporters [BR:mlk02000]  Other transporters   Pores ion channels [TC:1]    131817775 (BAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 TetR_C_30 CF222 Motif Other DBs NCBI-GeneID:  131817775 NCBI-ProteinID:  XP_059007360 LinkDB All DBs Position 16:complement(55890574..55894256) Genome browser AA seq 192 aa AA seqDB search MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELALEQAPQDASTKKLS ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggacgggtccggggagcaacccagaggcggggggcccaccagctctgagcagatcatg aagacaggggcccttttgcttcagggtttcatccaagatcgagcagggcgaatgggggga gagacacccgagctggcccttgagcaggcgccacaggatgcatccaccaagaagctgagc gagtgtctcaagcgcatcggagatgaactggacagtaacatggagttacagaggatgatc gcagctgtggacacagactccccccgcgaggtctttttccgagtggcagctgaaatgttt tctgatggcaacttcaactggggtcgggtcgttgccctcttctactttgccagcaaactg gtgctcaaggccctgtgtaccaaggtgcccgagctgatcaggaccatcatgggctggaca ctggacttccttcgagagcgactgctgggctggatccaggaccagggtggttgggacggc ctcctctcctactttgggacacccacgtggcagacagtgaccatctttgtggctggagtg ctcactgcatcactcaccatctggaaaaagatgggctga

DBGET integrated database retrieval system